Les actualités à Madagascar du Vendredi 28 Juillet 2017

Modifier la date
News Mada3455 partages

Fanomezam-boninahitra: tsy voahaja ny fisaonana ho an’i Régis Gizavo…

Mitohy ny tandrametaka sy ny kitoatoan’ny fitondrana. Maro ireo birao na tranom-panjakana ahitana ny sainam-pirenena, tsy nanaraka ny fisaonam-pirenena nambaran’ny fanjakana fa tokony hatao, omaly noho ny fahalasanan’ilay mpanakanto andrarezina, Régis Gizavo. Anisan’ny tsy nampidina ny saina teo amin’ny antsasany ny etsy amin’ny tobin’ny zandary Ankadilalana, ny minisiteran’ny Varotra, ny minisitera sasany etsy Anosy. Tahaka izany koa ny toeram-pianarana ambony Inscae sy ny Havana 67 ha. Hatreny amin’ny hopitaly manara-penitra… Tsy vitan’izany fa hatrany amin’ny haino aman-jery aza, vitsy ireo mba nanaraka izany ka nandefa hira milamindamina na koa nandefa tsy an-kiato ny hiran’ity mpanakanto ity. Ho an’ny olom-pirenena tsotra indray, maro ireo tsy mahalala izany akory. Na ireo lanonana samihafa aza, tokony ho foana avokoa raha tena fisaonam-pirenena. Midika ireo fa eo aloha ilay seraseran’ny fitondrana sy ny fampahafantarana na koa fanentanana tsy mahomby na tsy ampy.

Efa maty hatrany vao Ramalala

Eo mihitsy koa ny tsy fahaizana  ka tsy mahagaga raha tsy hita taratra akory ny fiaraha-miory. Tokony ho hita ety ivelany anefa izany  ary arahina fisaonana nefa toa nohadinoina na nanaovana fanahy iniana ? Tokony ho hita maso ary ao am-po izany fisaonana izany…

Mazava koa ilay fanapahan-kevitra petatokon’ny fitondrana fa natao hanaronana ilay tsy firaharahana ny mpanakanto fony fahavelony ny nandraisana ilay fepetra ho fisaonam-pirenena. Tsy mba anisan’ireo nahazo mari-pankasitrahana na mari-boninahitra i Régis Gizavo.  “Rehefa maty vao mihazakazaka foana manome voninahitra na koa fisaonam-pirenena. Tsy aleo ve hatolotra azy dieny mbola velona  izany haja sy voninahitra mendrika azy izany. Izao lasa fihatsarambelatsihy fotsiny ?”, hoy ny depiote Randrianarisoa Guy Rivo.

Randria

News Mada3198 partages

Tantara, kolontsaina, vakoka: entanina hahafantatra an’Analamanga ny lehibe

Manomana tetikasa hoenti-mampahafantatra bebe kokoa ny faritra Analamanga, ny tantara, ny kolontsaina ary ireo vakoka marobe ao aminy ny Ofisim-paritry ny fizahantany (Ortana), mandritra ity fotoam-pialan-tsasatra. Tsy ny ankizy sy ny tanora indray no kendrena amin’izany fa ny olon-dehibe mihitsy.

Mandritra io volana aogositra sy septambra io àry, hisy ny fitsidihana maimaimpoana ireo toerana mampiavaka ity Renivohitra ity. Tsy an-tongotra io fa amin’ny fiara. Misy isaky ny alarobia sy ny asabotsy ity hetsika ity. Ho fantatra miandalana kosa ny toerana hiaingan’ny fitsidihana.

Etsy ankilan’izay, miato kely aloha ny « Classe patrimoine », tetikasa tanterahin’ny Ortana, mandritra ity fotoam-pialan-tsasatra ity. Samy manana ny fandaharam-potoany mantsy ny ankizy sy ny isan-tokantrano. Raha tsiahivina, amin’ny alalan’ity tetikasa ity no itondran’ny ofisy ireo mpianatra amina sekoly na koa ankizy sy tanora amina fikambanana samihafa, mitety ireo toerana mahaliana eto Iarivo.

Ankoatra ny tsidi-bohitra an-tongotra sy ny fitetezana ireo toeram-pizahantany eto afovoan-tanàna, hetsika iray hafa isarihana ny mponina sy ny vahiny eto an-dRenivohitra ny « Hiragasy makotrokotroka », isaky ny alahady hariva, etsy Ambohijatovo.

Landy R.

Midi Madagasikara522 partages

Morombe: Naverin’ireo mpangalatra ny lakolosim-piangonana no sady nangata-bavaka izy ireo

Fifaliana lehibe ny any an-danitra raha misy mpanota iray mibebaka, hoy ny Fampianarana. Asa raha izany tokoa ity nitranga tao Morombe, omaly maraina ity, raha naverin’ireo mpangalatra tamin’ny toerana ny lakolosim-piangonana iray, izay efa tsy hita ho herintaona mahery teo izay. Omaly maraina, hagagana miharo hafaliana ny an’ireo mpiangona tao amin’ity fiangonana iray tany an-toerana raha nahita ny lakolosin’izy ireo very, ka hita indray, ary nipetraka tsara teo amin’ny toerany. Nampandrenesina avokoa ireo tompon’andraikitra tamin’ity fahagagàna vao maraina ity. Tsy vitan’ny hoe naverin’ireo mpangalatra mantsy ilay lakolosy fa mbola narahan’izy ireo hafatra tao anatiny. Hafatra izay milaza ny fanenan’ireo olon-dratsy nangalatra izany fitaovam-piangonana izany fa indrindra fangataham-pamelàna sy vavaka amin’ireo mpiangona ho azy ireo. « Indro ny fananan’ny Tompontsika fa averina (…) efa nibebaka teo anatrehan’i Tompontsika izahay nefa mangataka vavaka aminareo ihany koa. Ary manaiky fa tsy hamerina intsony » hoy ny vakin’ny sasantsasany amin’ilay hafatra navelan’ireo mpangalatra tao anatin’ilay lakolosy naverin’izy ireo. Dia asa tokoa raha tena niova fo ry zalahy ireto na hoe, efa tsy nisy nandray intsony ilay lakolosy ka hany hery dia naverina tamin’ny tompony. Nisy fotoana tokoa nampalaza ity fangalarana lakolosy ity teo amintsika. Tsy teto am-povoan-tany ihany fa na tany amin’ny faritra aza, ary  ireo tanana somary lavitra andriana no tena nahita faisana. Efa nisy mihitsy ny « fampanenoana lakolosy » nataon’ireo mpitondra fivavahana, ho fanairana ireo mpitondra fanjakana tamin’io tranga io. Hatreto dia mbola tsy voavaly ilay fanontaniana hoe natao inona ireo lakolosy ireo, izay nalaza tamin’izany fa misy sahy mividy lafo dia lafo tokoa.

m.L

L'express de Madagascar465 partages

Mandrosoa Ivato – Accident spectaculaire

Ils l’ont échappé belle. Les neufs passagers de trois véhicules pris dans un violent carambolage hier soir à Mandrosoa s’en sont sortis avec des blessures. Pourtant, à en juger l’état des voitures après la collision, on aurait pensé au pire. Une Peugeot 3008 venant d’Ivato a été l’origine du choc. Roulant à vive allure, elle a raté le virage au niveau de la bifurcation vers l’hôtel le Paon d’or et a heurté de plein fouet une Toyota Prado et une Opel Combo, scindée en deux, allant vers Ivato. Le choc a été d’une violence inouïe. Par miracle, il n’y eut que des blessés.

Midi Madagasikara320 partages

Hopitaly teto Tanà: Raikitra ny totohondry tao amin’ny “urgences”

Tsy fifanajana no anton’ny disadisa ary samy nahita ny roa tonta, fa nisy fahadisoana na ny andaniny na ny ankilany. Andaniny, olona milaza azy ho mahitahita ka tsy maintsy ny marariny no alefa mialoha. Ankilany, ny mpitsabo sy ny mpanampy azy ; izay sady nandray ny marary no nisy niantso an-telefaonina ka namaly izany. Izay fifanandrifian-javatra izay no niteraka ny hasosorana tamin’ireo olona nitondra marary ary namonkona totohondry avy hatrany. Dia tena nikasi-tànana tokoa ary naratra hatramin’ny mpitsabo. Niditra an-tsehatra nanampy ny mpitsabo mpanampy ary mbola naratra ihany koa. Tonga hatramin’ny fiantsoana mpitandro ny filaminana mihitsy satria nanakorontana tao amin’ny sampana fameloman’aina izany tranga izany. Na ny marary hafa aza nikorotan-tsaina vokatry ny sakoroka izay nisy tamin’ny toerana izay tena ilana fahanginana sy filaminana satria iankinan’ny ain’olona. Mahitahita tokoa ilay olona satria na ny mpitandro ny filaminana izay nantsoina aza dia niala bala ary tsy tonga akory aza, eny fa na dia efa misoratra eo amin’ny rindrin’ity sampana fameloman’aina ity aza ny laharan’izy ireo ary na dia efa nisy ihany koa aza ny fifanaraham-piaraha-miasa fa miditra an-tsehatra avy hatrany izy ireo rehefa misy tranga fanakorontana ny hopitaly, indrindra ny sampana fameloman’aina. Tafalatsaka ambany tanteraka ny toe-tsain’ny olona sasany ankehitriny. Ny olona hitsabo indray no nomena totohondry. Tonga amin’ny fitenin’ny Ntaolo hoe : « miady amin’ny mpangarom-bilany ». Na izany aza anefa tokony hieritreritra ihany koa ny mpitsabo sasany amin’ity fampiandrasana marary ity, satria tena maharary ny olona izany, saingy tsy afa-manoatra izy ireo satria tsy misy safidy. Izany rehetra izany no mitambatra tamin’ity indray mitoraka ity no niteraka sahotaka sy totohondry…

D.R

L'express de Madagascar278 partages

Formation – L’Iscam à l’heure l’internationale

Dans le milieu du travail, il est difficile d’acquérir une formation à l’étranger. Le certificat Edaf ou EFMD Deans Across Frontiers permet de se former durant quelques mois dans des grandes écolesL’Institut Supérieur de communication, des affaires et du management (Iscam) est la première école en Afrique et parmi les pays francophones à obtenir la certification .La cérémonie de remise de ce certificat s’est déroulée, hier à  Ankadifotsy.  Il s’agit d’un programme d’accompagnement établi par l’European Foundation for management development (EFMD). « L’octroi de ce certificat permet à l’Iscam de s’ouvrir au monde en ayant plusieurs partenaires. Les étudiants peuvent étudier quelques mois à l’étranger dans des écoles partenaires et les étudiants de l’étranger peuvent venir dans notre école aussi sans payer les frais de scolarité », affirme Lylar Herimanitra, doyen à l’Iscam.

« Learning model »Plusieurs critères ont été recommandés pour l’octroi de ce certificat dont le partenariat avec les entreprises, la rénovation du local, la naissance du «learning model», une politique d’enseignement basée sur l’apprentissage avec la pratique. Ainsi, la formation des étudiants se fait davantage par des projets associatifs, des accompagnements dans la relation avec lesentreprises.En 2011, l’Iscam a assisté à une conférence sur le business school en Afrique du Sud. Le certificat Edaf y avait été présenté. C’était une occasion à saisir afin de mieux accompagner les jeunes. « Nous avons toujours pensé que la force des écoles, c’est la force des étudiants. Nous pouvons améliorer le système à regarder au-delà des étu­diants », explique Jaona Ranaivoson, directeur général associé de l’Iscam.

Mamisoa Antonia

Midi Madagasikara190 partages

Pauvreté, insécurité et crise de confiance

Madagascar est encore dans  un état de pauvreté absolue. Et ce ne sont pas les actions de communication réalisées à travers les supports de communications (journaux, télévisions, réseaux sociaux) inféodés  au HVM qui pourront démontrer  le contraire.

Pauvreté, insécurité et crise de confiance

Chaque jour que Dieu fait, on assiste à cette paupérisation constante de la population malgache. A cela s’ajoute cette insécurité grandissante aussi bien en ville que dans les campagnes, ou encore sur les routes nationales, où les bandits de grand chemin détroussent les passagers des transports en commun. Et tout cela, dans une quasi-impunité puisque faute de moyens humains, matériels et financiers suffisants  et malgré leur volonté, les forces de l’ordre ne peuvent pas faire grand-chose. Les bailleurs de fonds font,  chaque fois que l’occasion se présente, des efforts pour aider le pays à mettre fin à  cette situation générale de  pauvreté et d’insécurité. Lors de la présentation, hier du nouveau cadre de partenariat pays de la Banque mondiale, il a été, d’ailleurs, de nouveau question de la nécessité absolue de renforcer la résilience des populations et de promouvoir une croissance inclusive afin de permettre une avancée nette dans la lutte contre la pauvreté. Les bailleurs de fonds sont prêts et s’activent pour sortir Madagascar de cette pauvreté.   Ils estiment  que pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, qu’elles soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises. L’une des conditions pour parvenir à ces objectifs de retour à la croissance est la mise en place d’une gouvernance administrative, économique et politique, soutenue par des institutions nationales et locales fortes. Mais la question qui se pose est de savoir si les dirigeants actuels fournissent effectivement des efforts pour y arriver. Car au point où on en est actuellement, la grande majorité de la population n’a plus confiance en ce régime qui n’arrive pas à la sortir du marasme socioéconomique. Une crise de confiance sans précédent.

R.Edmond.

Midi Madagasikara94 partages

Banque mondiale: 1,3 milliard USD pour huit changements majeurs

Madagascar doit pouvoir sortir du cercle vicieux de la pauvreté, grâce à l’amélioration de la résilience, la réduction de la fragilité et la promotion d’une croissance inclusive.

 

Si l’on se réfère aux années passées, une forte potentialité de croissance économique est constatée à Madagascar, en période de stabilité. C’est ce qu’a affirmé Coralie Gevers, Country manager de la Banque mondiale à Madagascar, lors de la présentation officielle du Cadre de Partenariat Pays (CPP), qui s’est tenue hier au « Plan » Anosy. En effet, ce document CPP est celui approuvé par le Conseil d’Administration du Groupe de la Banque mondiale, le 27 juin dernier, et qui bénéficie d’un financement de 1,3 milliard USD pour la période 2017-2021. Elaboré en consultation avec le Gouvernement et d’autres parties prenantes et aligné sur le Plan National de Développement, le CPP, vise à aider Madagascar à accroître la résilience des personnes les plus vulnérables à favoriser une croissance inclusive, et à mobiliser d’importants investissements privés pour le développement, tout en renforçant les institutions nationales et locales afin de réduire la fragilité.

Objectifs. Le financement attribué à ce Programme s’inscrit dans le cadre des engagements annoncés lors de la Conférence des Bailleurs de fonds et Investisseurs en décembre 2016 à Paris, pour soutenir des réformes et permettre des interventions à impact élevé dans les domaines du développement humain, de l’agriculture résiliente, de l’inclusion financière et de l’énergie. Parmi les actions prévues dans le CPP figurent le renforcement du développement humain des enfants ; l’amélioration de la résilience des moyens de subsistance des ménages vulnérables dans les zones rurales et urbaines ; la décentralisation améliorée et efficace ; le renforcement de la transparence et de la redevabilité ; l’augmentation de la capacité fiscale à financer les dépenses sociales et les infrastructures prioritaires ; l’amélioration de l’environnement des affaires et l’accès au financement ; le renforcement de la productivité rurale ; et l’amélioration de l’accès à l’énergie et au transport.

 

Antsa R.

News Mada89 partages

Fampianarana ambony: nahazo ny certificat EDAF ny Iscam

Taorian’ny fanarahan’ny sekoly ambony momba ny varotra sy ny fitantanana Iscam fandaharanasa ahitana tantsoroka ho an’ny ivontoeram-pampianarana EDAF, nahazo ny certificat EDAF manamarina izany ny tomponandraikitra, omaly teny Ankadifotsy. Natokana ho an’ny sekoly ambony momba ny varotra sy ny fandraharahana ny tohana ka noho ny fanarahan’ny Iscam ny fepetra rehetra takina amin’izany, nomen’ny European Foundation For Management Development (EFMD) azy ireo ny EDAF. Anisan’ny fepetra napetraka ny fanovana ny fandaharam-pianarana sy ny fanavaozana ny toeram-pampianarana. Ny taona 2011 no nanatrika atrikasa momba ny « business scholl » tany Afrika Atsimo ny mpitantana ny Iscam ary nitsiry ny hevitra hirosoana amin’izany. Toeram-pampianarana anisan’ny nahazo voalohany izany “certificat” izany aty Afrika sy amin’ny firenena mampiasa ny teny frantsay ny Iscam, araka ny fanazavan’ny tale jeneraliny, Ranaivoson Jaona.

Vonjy A.  

Midi Madagasikara73 partages

Régis Gizavo: Des artistes et journalistes étrangers vont se déplacer pour son enterrement

Quand tu étais né, tu pleurais, mais tout le monde autour de toi riait. Vis ta vie de manière à ce qu’à ta mort tout le monde pleure et toi, tu souris ». Sa vie, Régis Gizavo l’a menée ainsi. De cet accordéoniste qui a porté très haut le flambeau malgache, ceux qui l’ont côtoyé et connu ont surtout gardé le souvenir, non du musicien, de « la star », mais de l’homme, généreux et humble qu’il était. Erick Manana, Christophe Maé, Monika Njava, D’Gary… tous pleurent le « frère » qu’ils représentaient pour eux. La presse internationale, les journalistes qui ont eu l’occasion de le côtoyer: France : TV5, rfi musique, Le Monde, Gala, Purepeople, Telestar, Voici Mundofonías… n’ont donc pas manqué de lui rendre hommage. Pour ses funérailles qui se tiendront demain 29 juillet à Andranomena Tuléar, bon nombre de ces mêmes  journalistes et artistes avec lesquels il a collaboré seront présents pour un dernier adieu à l’artiste.Mahetsaka

Midi Madagasikara71 partages

Port Bergé: Collision entre un minibus et un car, 03 morts et 22 blessés

Port Bergé Collision entre un minibus et un car, 03 morts et 22 blessés

Hier vers 9h30, un accident grave s’est produit sur la Route nationale n°4. La collision entre deux taxis-brousse a fait trois morts et 22 blessés dont cinq graves. Le drame a eu lieu dans le district de Port Bergé quand un car taxi-brousse desservant la ligne Mandritsara-Mahajanga a percuté de plein fouet un minibus transportant des voyageurs en provenance de Mampikony. La violence du choc a projeté le minibus et l’a réduit en un tas de ferrailles. Ce qui a blessé tous les occupants du minibus dont  trois ont été tués sur le coup.  Le deuxième véhicule, qui est un camion aménagé en taxi-brousse a   vu sa cabine détruite.  En effet, quatre de ses passagers ont été blessés.Pour le moment, la cause exacte de l’accident n’est pas encore identifiée. Encore sous le choc les chauffeurs des deux véhicules n’étaient pas encore en mesure de s’exprimer quand nous avons reçu cette information. Pourtant, les témoignages de certains passagers ont révélé que le car a roulé à tombeau ouvert. Une manière de conduire qui est monnaie courantechez les chauffeurs de ce genre de taxi-brousse en forme de camion desservant cette partie de la Grande Ile qui est traversée par la RN4 et la RN6. Toujours selon les témoignages des passagers, ce n’est pas la première fois qu’on voit des taxis-brousse de ce genre  se mesurant avec des Sprinters sur ces axes.

Cet accident permet de dire que le respect du code de la route est loin d’être inculqué dans l’esprit de nos chauffeurs. Irresponsables, ces chauffeurs et les coopératives qui les emploient ne se rendent-ils pas  compte que la vie des passagers qu’ils transportent se trouve entre leurs mains ? Heureusement que dans cet accident survenu à Port -Bergé, les coopératives à qui relèvent les voitures incriminées ont déjà pris leur responsabilité respective.

T.M.

News Mada52 partages

Baolina kitra: nahazo 1 tapitrisa Ar avy ny mpilalaon’ny Barea

Nigadona an-tanindrazana ny talata 25 jolay lasa teo ny Barean’i Madagasikara, avy natrika ny lalao tany Mozambika. Noraisin’ny Federasion’ny baolina kitra (FMF) izy ireo ary notolorana fankasitrahana ireo mpilalao.

Samy notoloran’ny FMF vola iray tapitrisa Ar avy ireo mpilalao avy nandrandro lalao tatsy Mozambika ny herinandro teo. Tafiditra amin’ny fifanintsanana amin’ny “Chan 2018”, hatao any Kenya amin’ny taona ho avy izany izany lalao izany ka nandresentsika 2 no ho 0 ny Mambas. Nankasitrahan’ny mpitantana ny baolina kitra, notarihin’ny filoha amperinasan’ny FMF,  Andriamiasasoa Doda  izy ireo tamin’izany ary izao nomena fankaherezana teny Isoraka izao.

Ankoatra izany, miantso ny rehetra amin’ny fanohanana ny Barea ilay mpilalao matihanina, Faneva Imma any Frantsa, amin’ny alalan’ny tambajotran-tserasera. Anisan’ny tolo-keviny amin’izany ny fanentanana ny rehetra hividy ny fanamian’ny ekipam-pirenentsika. Fomba efa fanao any ivelany rahateo ny tahaka izany.

Tokony hahay hanohana ny rehetra

Tsiahivina fa niakatra hatrany ny lentan’ny baolina kitra eto amintsika tao anatin’ny herintaona izao. Izany hoe, nanomboka ny 3 septambra 2016 noho mankaty. Nahavita lalao iraisam-pirenena miisa 11. Nahazo fandresena imbalo ary ady sahala telo.

Manoloana izany, tokony hahay hanohana sy hanampy ny Barea ny rehetra, fa tsy hamerina na hanao toy ny niatrehan’izy ireo ny Mozambikanina tetsy Mahamasina farany teo. Nanaraby sy nihorakoraka ny hadisoan’ny mpilalao na ny tsy fetezana eny ambony kianja… Tokony hahay hijery baolina… Tsy ho sakaizan’ny mpandresy foana koa anefa satria boribory ny baolina.

Synèse R.

News Mada50 partages

Fanampian’ny Banky iraisam-pirenena (CPP)*: 50 % fanomezana, 50 % trosa tsy misy zana-bola

Nampahafantarina, omaly, ny fankatoavan’ny filankevi-pitantanan’ny Banky iraisam-pirenena ny fiaraha-miasa vaovao eo amin’i Madagasikara sy ity mpamatsy vola ity (CPP). Nanatrika ny fotoana fampahafantarana izany, ny minisitry ny Toekarena, Raveloharison Herilanto ; ny minisitry ny  Fitantanam-bola, Andriambololona Vonintsalama, sy ireo avy amin’ny sehatra maro. 

Fiaraha-miasa manomboka ny taona 2017 hatramin’ny 2021, novolavolaina sy nakan-kevitra tamin’ny fitondram-panjakana malagasy sy ny sehatra hafa, araka Drafitrasam-pirenena ho an’ny fampandrosoana (PND). Famatsiam-bola amin’ny alalan’ny IDA, homen’ny Banky iraisam-pirenena : 50 % fanomezana, 50 % trosa tsy misy zana-bola, haverina ao anatin’ny 38 taona, mety miampy fanalavam-potoana enina taona. Kendrena manokana hisy akony any amin’ireo sokajin’olona mahantra, handraisan’izy ireo anjara feno amin’ny asa fampandrosoana, sy hitarika fampiasam-bola avy amin’ny tsy miankina.

Vonona hamatsy 1,3 miliara dolara ny Banky iraisam-pirenena, araka ny tapaka tany Paris, desambara 2016, amin’ny asa fanavaozana rehetra sy amin’ny sehatry ny fambolena, angovo, sosialy. « Isaorana ny Banky iraisam-pirenena amin’izao fanavaozana ny fiaraha-miasa izao ho fandraisan’ny rehetra anjara feno hiadiana amin’ny fahantrana. Mitaky fitantanana tsara fototra sy matanjaka izany eo amin’ny lafiny toekarena sy politika », hoy ny minisitry ny Toekarena, Raveloharison Herilanto.

Ady amin’ireo mampisongadina ny fahantrana

Ao anatin’io CPP io ny tokony hahitana fampandrosoana marina mipaka any amin’ny vahoaka. Tanjona, alohan’ny 2021, ny hampihena isan-taona ny ankizy tsy ampy sakafo ; hampitombo 25 % ny ankizy mahavita fianarana ambaratonga voalohany ; ary hampiakatra avo roa heny ny tahan’ny fahazoana herinaratra. Anisan’ny singa mampisongadina ny fahantrana eto Madagasikara ireo naroson’ny Banky iraisam-pirenena ireo. “Tokony ho hita taratra ny fiarovana ny maro anisa mahantra manoloana ny loza voajanahary sy fiovan’ny toetr’andro », hoy ny solontenan’ny Banky iraisam-pirenena, Coralie Gevers.

Hisian’ny fandraisana anjara amin’ny fampandrosoana feno sy maharitra, tsy maintsy kajina hanana ny hoaviny azo antoka, manomboka amin’ny fahatanorany, ny mponina. Afaka miasa ara-dalàna, fampiasam-bola mametraka fotodrafitrasa matanjaka, tontolon’ny fihariana azo antoka, ho an’ny orinasa madinika na salantsalany. Ilaina, araka izany, ny fampiharana marina ny fitsinjaram-pahefana.

R.Mathieu

CPP* : Cadre de partenariat pays.

News Mada49 partages

Pratiques institutionnelles: garant de la réussite d’un système économique

L’Etat et le marché comme institutions principales sont les vecteurs de la promotion et du développement l’économie malgache. Cependant, plusieurs dysfonctionnements ponctuels sont constatés. Les institutions constituent pourtant les pièces maîtresses dans le fonctionnement du système économique.

Il existe une relation étroite entre institution et l’état de la pauvreté actuelle à Madagascar. C’est dans cette optique que le Cercle de réflexion des économistes de Madagascar (Crem) a choisi «Les enjeux de la pratique institutionnelle à Madagascar» comme thème du «Jeudi du Crem» d’hier.

Qualité de la pratique institutionnelle

Un des intervenants principaux à cette conférence-débat, le Dr Freddie Mahazoasy, vice -président de l’Assemblée nationale et président du comité exécutif de l’APCOI, a évoqué les aspects techniques des institutions comme les définit la Constitution. «Pour avoir un développement économique réel et soutenu, il faut une bonne qualité de la pratique institutionnelle. Elle est même déterminante. Outre la bonne gouvernance, il faut absolument inclure dans les instituions, dans un souci d’efficience, une dimension de l’innovation, en prenant compte par exemple de l’évolution des Tic», a-t-il expliqué.

En prenant en compte une autre dimension de l’institution, le Dr Rakoto David Olivaniaina, membre fondateur du Crem et non moins Doyen de la Faculté DEGS Antananarivo, a souligné que «Les institutions à valeur sociale et à valeur morale doivent faciliter la croissance. Elles devront s’améliorer avec le progrès technique. Si l’on veut vraiment atteindre un développement économique, il faut mettre en place et protéger les valeurs morales sociales…».

Pour le Crem, la réussite d’un système économique et la prospérité sont basées sur la résilience institutionnelle face aux chocs internes et externes de l’économie.

Arh.

Midi Madagasikara45 partages

Interdiction de Mahamasina: « Excès de pouvoir manifeste » du préfet selon le TIM

Voulant rester légalistes, les pro-Ravalomanana renoncent à leur manifestation prévue se tenir samedi prochain au stade de Mahamasina.

Les partisans de Marc Ravalomanana ne sont pas autorisés à manifester samedi prochain au stade municipal de Mahamasina.

Malgré le fait que le délai de 72 heures n’ait pas été respecté, le préfet de police d’Antananarivo a finalement donné suite hier à la demande d’autorisation de manifester formulée par le TIM dans le cadre de son 15e anniversaire. En effet, le Général Ravelonarivo Angelo a refusé cette demande qui devrait permettre aux militants de l’ancien président Marc Ravalomanana de manifester samedi prochain au stade municipal de Mahamasina. La commune urbaine d’Antananarivo, propriétaire du stade, a déjà accordé son autorisation. Les membres du bureau politique du TIM se sont réunis hier même à Faravohitra et ont réagi par un communiqué à la décision du préfet de police d’Antananarivo. Dans ce communiqué, le parti de l’ancien président Marc Ravalomanana dénonce l’excès de pouvoir du Général Ravelonarivo Angelo. « Nous estimons que la décision du préfet ressort d’un excès de pouvoir manifeste. », affirme le communiqué. Avant de rajouter : « Mais, dans un esprit d’apaisement et dans un souci de profond respect de la loi, nous nous y conformons. »

Pas de recours. En un mot, il n’y aura pas de manifestation samedi prochain au stade de Mahamasina dans le cadre de la célébration du 15e anniversaire du TIM. Cette fois-ci, suite à la décision de refus du préfet de police d’Antananarivo, le parti de l’ancien président n’a pas saisi la juridiction compétente (tribunal administratif) pour demander l’annulation et le sursis à exécution de l’acte pris par ce représentant de l’Etat. Par contre, les partisans de Marc Ravalomanana rappellent dans leur communiqué qu’il n’y a pas eu de manifestation sur la voie publique le 08 juillet dernier. « Les gens empêchés de pénétrer dans le stade malgré le jugement n° 59 du 07/07/2017 du Tribunal Administratif les y autorisant ont tenu à ramener le président Ravalomanana Marc en sa demeure à Faravohitra. », soutiennent-ils. Et eux de poursuivre dans leur communiqué : « Il n’y a eu aucun incident sur leur passage : aucune personne blessée, aucun magasin vandalisé, aucune voiture détruite ou cassée et ce, malgré les tirs de gaz lacrymogènes utilisés à mauvais escient par les forces de l’ordre. Les forces de l’ordre eux-mêmes l’ont attesté sur les différents médias (radios, télévision et et  presse écrite). »

Légalistes. Bref, les partisans de l’ancien président veulent montrer qu’ils restent légalistes face à l’ « excès de pouvoir manifeste » du préfet de police d’Antananarivo. Cette fois-ci, le TIM ne veut plus engager une bataille judiciaire avec la préfecture de police. Marc Ravalomanana préfère agir au niveau international pour combattre l’autoritarisme du pouvoir HVM. C’est dans ce cadre qu’il a rencontré il y a quelques jours à son domicile à Faravohitra une forte délégation sud-africaine conduite par l’ambassadrice de l’Afrique du Sud à Madagascar. Marc Ravalomanana a dénoncé durant cette rencontre les agissements du régime en place qui empêche jusqu’à présent le « Tiako I Madagasikara » de célébrer dignement et à la hauteur de son ambition son 15e anniversaire.

Eugène
Tia Tanindranaza43 partages

Ravalo sy ny TIMTsy hahita rariny amin’ny fanjakana

Nolavina ny fangatahan’ny Antoko Tiako I Madagasikara hanatanteraka ny fanamarihana ny faha-15 taonany eny amin’ny Kianjaben’i Mahamasina ny sabotsy 29 jolay izao.

 

L'express de Madagascar42 partages

Fiascolaire

Le constat établi par la Banque mondiale sur l’Éducation se confirme. Les résultats des examens scolaires sont accablants. Le taux de réussite est en baisse constante. Pire, dans certaines régions, il tend vers zéro. Il fut un temps où l’on parlait de zéro redoublement, désormais la tendance est le zéro admis.Certes, pour des endroits où les dahalo sont les maîtres avant les enseignants, les intempéries font la pluie et le beau temps, les résultats peuvent s’expliquer en partie.Dans les grandes agglomérations, les frais de scolarité, les frais de transport, le coût des fournitures scolaires, le coût de la vie en  général … sont autant de paramètres, causes de cette baisse du niveau des élèves, de ce «fiascolaire»..La parade du ministère de l’Éducation nationale argue qu’il faut des têtes bien faites et non des têtes bien pleines de sujets types appris mille fois, qu’il faut relever le niveau et non le taux de réussite. Une belle esquive pour ne pas admettre l’évidence.Les sujets ont été ainsi compliqués pour mettre à contribution l’intelligence des élèves. Mais comparés aux sujets au Cepe ou au Bepc d’il y a quelques années, ceux de cette année sont du gâteau. Et dire que certains candidats trouvent corsée une question se rapportant à l’actualité politique quotidienne à l’épreuve de philo au baccalauréat. On ne s’étonnera pas que, pendant des décennies, on aura toujours affaire à des dirigeants qui n’ont jamais entendu parler de politique. Des parvenus de toutes sortes qui chamboulent toutes les valeurs qu’elles soient féodales ou républicaines et qui ne prient que pour deux valeurs sûres, en l’occurrence la corruption et l’anarchie.Ce n’est pas parce qu’il existe quelques surdoués, des diamants sertis dans un bloc de granite, qu’on pourra dire que tout brille. Le niveau des élèves est l’exacte réplique de celui des enseignants. Quand l’enseignant est incapable d’effectuer une division avec des chiffres décimaux, il ne faut espérer que l’élève puisse solutionner un problème de partage inégal.Il fallait donc s’y attendre depuis le recrutement massif d’enseignants sans qualification en 2014. Les ravages se feront davantage sentir au fur et à mesure. On n’en est qu’au début.Le relèvement du niveau ne se fait pas en un clic, encore moins en une opération de communication très pointue des activités du ministère. On doute fort que les réformes de l’Éducation confinées dans le fameux Plan sectoriel de l’Éducation, aille aggraver la situation. Les conditions ne semblent pas propices, a en juger les résultats pour entamer des réformes dont le budget est estimé a 1000 miliards d’ariary selon les responsables du Men. L’argent reste donc, à ce qu’il paraît, le déclencheur des réformes et l’Éducation demeure le cobaye de prédilection des apprentis chirurgiens depuis 1972. On se demande en quoi le changement de la période de vacances scolaires, comme il est prévu dans les réformes, puisse être d’un quelconque recours dans l’amélioration du niveau des élèves. Il en va de même de la longueur du cycle scolaire. Le primaire va être rallongé de manière à ce que le diplôme habituellement demandé aux femmes de ménage (le Cepe) sera rayé des tablettes. L’abandon scolaire risque de s’amplifier étant donné la longueur exaspérant du cycle primaire.L’Éducation est un domaine délicat. C’est la base du développement. Il ne faut pas s’évertuer à procéder à des réformes quelques années après avoir pris les commandes du ministère et remettre en cause de but en blanc un système qui a nécessité de longues recherches.Les alertes sont assez claires et suffisantes pour ne pas faire les choses à la légère.

Par Sylvain Ranjalahy

Madagate41 partages

Mamy Rakotoarivelo. Les raisons de son suicide? L’argent et les femmes selon lui-même

Mamy Rakotoarivelo, bras droit de Marc Ravalomanana, à l'apogée de la société Tiko, a été retrouvé mort, ce matin du 28 juillet 2017, dans son domicile sis à Ankadifotsy. Il se serait tiré dans la tête. Étrangement, les gens de maison affirment avoir entendu deux coups de feu. Encore un mystère à élucider car il est impossible de se tirer une seconde balle dans la tête. Mais, quoi qu'il en soit, il est bien mort et reposera à jamais dans son Vakinankaratra natal.

Ce 5è suicide aura été le bon pour Mamy Rakotarivelo. Mais pourquoi voulait-il mettre, à tout prix, fin à sa vie terrestre depuis son divorce avec Juliana Andriambelo?

Rappelons que Mamy Rakotoarivelo, alors Directeur général de la MBS (Malagasy Broadcasting System) appartenant a, lui-même, vécu une tragédie aussi tragique qu'inattendue. En effet, l'Anglaise Alexandra Smith, la fiancée qu'il allait épouser en février 2016 -il l'avait lui-même annoncé à des journalistes, à son domicile, en novembre 2015-, trouve la mort à Paris, le 26 novembre 2015. Jusqu'ici, nul ne connaît les circonstances exactes de cette disparition subite.

Dès le début d'après-midi de ce 28 juillet 2017, les gens ont commencé à s'agglutiner devant le portail du domicile de Mamy Rakotoarivelo, sis à Ankadifotsy

Pour en revenir à la triste nouvelle du jour, ce qui suit a été rédigé par Mamy Rakotoarivelo lui-même, le soir du 27 juillet 2017, la veille de son suicide annoncé.

« Je voudrais me confier à mes amis sur fb de mes soucis graves actuels comme dit l’adage malgache: « Alahelo tsy ambara havana, hono, mbola zakan’ny tompony ihany ». Et comme je ne le supporte plus, je me confie à vous sur les deux points suivants:

1) Comme la plupart d’entre vous le savent, j’ai divorcé de ma femme Juliana Faralalao ANDRIAMBELO en 2004. La grosse du jugement du tribunal stipule bien le partage moitié/moitié des biens communs. Ce partage n’a été fait qu’en 2016 pour diverses raisons. Après une entrevue avec M. le Procureur Général, il a été décidé que ce partage serait fait à l’amiable.

Tout s’est fait tranquillement jusqu’au partage des bons de caisse anonymes. Je tiens à signaler que j’étais le DG de Midi Madagasikara S.A. de 1994 à 2002 et j en ai fait rentrer de l’argent dans la société, d’autant que j’ai créé Midi Turf qui s’est vendu par centaines de milliers d’exemplaires par jour de 1997 à 1999, et j’ai créé aussi Gazetiko qui est devenu le premier quotidien de Madagascar.

Avant d’intégrer Midi Madagasikara, j’ai convenu avec ma belle-mère, Mme Marthe Rajaofera ANDRIAMBELO, actionnaire majoritaire de la société, que les bénéfices seraient répartis moitié/moitié. Et comme je l’ai souligné plus haut, l’argent coulait à flots, bien que ma belle-mère était réticente à la création de Midi Turf et de Gazetiko. D’ailleurs, j’aurais pu faire imprimer ces deux journaux ailleurs.

Toutes nos parts de bénéfices, je les ai confiées à ma femme qui les a placées en bons de caisse anonymes. Lors du partage des biens, il était légitime que je prenne une partie des bons de caisse anonymes. Après une grosse bagarre, mon ex femme a accepté de me donner un milliard de fmg qu’elle allait me donner en fonction de ses possibilités immenses par ailleurs.

C’est là que les problèmes sont apparus parce que depuis l’accord intervenu fin décembre 2016, elle ne m’a donné en tout et pour tout que moins de 50 millions de fmg. Je lui ai demandé à plusieurs reprises de me donner 200 millions de fmg pour m’acheter une voiture mais à chaque fois, elle me disait qu’elle n’avait pas d’argent. Comme là, elle part au Canada en vacances, elle ne pouvait plus dire qu’elle n’avait pas d’argent. Et pourtant, lorsque j’ai demandé 25 millions de fmg, j’ai dû faire des pieds et des mains avant de les obtenir. J’ai même dû accepter de renoncer au reliquat de 950 millions de fmg mais c’est du blabla que j’ai accepté de signer comme ça et là, je persiste et signe qu’elle me doit encore 950 millions de fmg. Au cas où il m’arrive quoi que soit, elle devra s’en acquitter auprès de ma sœur, Misaharivoloniaina Razakahajaina RASOLOFO.

2) J’ai confié une grande partie de la vente des montres de luxe résultant du partage des biens à ma copine de l’époque, ANDRIANIVOSON Tiavina Corinne (plus connu sur fb sous le pseudo de Corinne Asmiël).

Début mai, je lui ai demandé de me rendre les cent millions de fmg restants. Sa mère, Nirina RAJOELSON, m’a proposé de les faire tourner avec des vendeurs de pierre et d’en tirer le double après. Ne voyant pas l’argent venir au bout d’un mois et demi, j’ai râlé et elles m’ont demandé de patienter jusqu’au jour où elles m’ont appelé pour me dire soit disant qu’elles se sont fait prendre les cent millions de fmg par un pickpocket.

Et elles ont attendu plus de deux mois pour me le dire. Je crois plutôt qu’elles ont plutôt utilisé l’argent pour autre chose. Elles aussi me doivent cette somme et dans le cas où il m’arriverait quelque chose, elles devront s’en acquitter auprès de ma sœur susnommée.

Voilà les problèmes qu’il fallait que j’évacue auprès de vous, chers amis de Facebook et je vous remercie de votre attention et de votre compréhension. Je sais que quelques uns d’entre vous me prendront pour un fou mais j’ai toujours été trop honnête au point d’être naïf ».

 

 

Recueillis par Jeannot Ramambazafy - 28 juillet 2017

Midi Madagasikara40 partages

PORTRAIT: Emma Rasoanantenaina, l’espoir de la lutte malgache

Emma Rasoanantenaina après sa victoire au Palais des Sports de Mahamasina.

A 20 ans, Emma Rasoanantenaina a décroché la médaille d’argent chez les moins de 53 kg aux Jeux de la Francophonie, au Palais des Sports de Treichville, Abidjan. Au-delà de la passion, la lutte est pour elle un moyen d’accéder à son rêve de devenir infirmière militaire.

Emma n’ estime pas que la lutte soit une discipline réservée aux hommes. En plus, elle évolue au sein du club des militaires COSFA.  La lutte, elle l’a connue grâce à son cousin Fabrice. En 2007, elle est rentrée au club COSFA où elle continue d’évoluer actuellement. « Au début,  c’était juste pour m’amuser et pour garder la forme. Je ne pensais pas que je pouvais faire carrière en tant que lutteuse, mais au fil du temps, cela a changé » a-t-elle expliqué. Depuis 2009, elle a régné en maître dans la catégorie des 48 kg, avant de s’imposer dans la catégorie des 53 kg en remportant le titre de championne de Madagascar. Elle a commencé son aventure au sein de l’équipe nationale aux Championnats d’Afrique junior à domicile en 2012. Elle a été sacrée vice-championne d’Afrique. Dans sa carrière, elle est soutenue par sa famille surtout par son père, qui croit en elle. Pour survivre dans cette discipline, il faut selon elle, beaucoup de courage tellement les entraînements sont rudes.

Battante. Considérée comme un bel espoir de médaille dans la capitale économique de la Côte d’Ivoire, la lutteuse a été envoyée par la Fédération pour participer au camp d’entraînement de la CONFEJES, une semaine avant le début des Jeux. « J’ai hérité d’un tirage clément. Ce n’était pas facile, mais une fois qualifiée pour la finale, je n’étais qu’à une marche de la médaille d’or » indique Emma. En plus, lors de ces compétitions, le niveau de stress atteint son paroxysme. « Un de mes défauts est que je me déconcentre facilement face à la pression ». Avec ses 51 kg, elle est de petite taille par rapport à ses adversaires, mais tout est question de technique et non seulement de force. « Emma a bénéficié du projet sport-études à l’Académie Nationale des Sports (ANS) à Ampefiloha. Elle est une battante et possède cette rage de vaincre. Ses efforts ont fini par payer, elle mérite cette médaille » estime le coach Rakotoniaina Aimé Michel. Pour Emma, l’important est de croire en ses rêves. « Cette année, je dois passer le Bacc, mais j’ai fait le choix d’accomplir mon rêve et de remporter une médaille aux Jeux de la Francophonie. Maintenant, mes yeux seront tournés vers les qualifications pour les Jeux Olympiques de Tokyo de 2020 ». Consciente qu’à Madagascar, la carrière sportive est éphémère et que le sport ne fait pas vivre, Emma va repasser son diplôme de baccalauréat l’année prochaine. « Je rêve de devenir infirmière militaire, c’est la raison pour laquelle, je m’accroche et surtout que je poursuis ma carrière au sein du COSFA » a-t-elle conclu.

T.H

News Mada38 partages

Analamaintso: «Unity concert» en toute solidarité

Quand les artistes de tout bord s’allient pour témoigner leur solidarité en faveur de la protection de l’environnement à travers le reggae, cela donne «Unity concert», qui entre dans  sa 4e édition cette année.

«Sauver la nature, c’est notre culture» c’est à travers ce leitmotiv que l’association Youth’nity s’active à promouvoir la musique reggae et à protéger. «Le reggae est notre moyen d’expression, mais nous essayons d’atteindre un plus vaste public», confie Jeremy Randriarimanga de Youth’Nity Madagascar.

Les artistes participant à cet ambitieux projet sont jeunes, impétueux, pleins de croyance en l’avenir mais écolos aussi. «Il faut savoir que les fêtes populaires génèrent une quantité importante de déchets. Notre objectif est justement de sensibiliser le plus grand nombre à appliquer à la lettre la règle des 3R : réduire, réutiliser et recycler», souligne Carine Ratovonarivo.

Au programme

Une session acoustique fera office d’inauguration de cette manifestation, le 2 août, à l’Is’art galerie Ampasanimalo. S’ensuivra le grand concert à Analamaintso Analamahitsy  avec la participation Wubani Spirit de Mayotte, Neguson de l’île Maurice, Mafonja et Mashmanjaka. «Nous allons donner un avant- goût musical de notre prochain album intitulé «Zavaboahary» sur scène» confie Dougl and the wave, qui sera le guest de cet événement avec Legara.

Une exposition à thème et un atelier de recyclage seront aussi programmés. «Il y a très peu de manifestations dédiées à la musique reggae dans la zone océan indien, voire en Afrique. De ce fait, les artistes internationaux sont avides d’échanges et de partages dans le but justement de développer cette collaboration», conclut Tanjona Rabearivony de l’association Sarondra.

Joachin Michaël

Midi Madagasikara34 partages

Vendredi joli

# Smile party au Palais des Sports Mahamasina. Pourquoi changer une formule qui gagne ?  Cette année encore, l’équipe de la rdj’s team revient pour faire danser les jeunes, surtout ceux qui viennent de passer leurs examens. Outre les diverses animations proposées sur les lieux et l’animation discothèque avec les gars de la rdj’s team, Arione Joy, Mr Sayda, Melanie Walker, Meizah, Rak Roots, Andriann, Jyuni et Jess Flavy One se relaieront également sur scène.# Tence Mena au Jao’s Pub Ambohipo. Ce soir, ce sera Tence Mena qui sera aux commandes. L’occasion pour la chanteuse de dévoiler ses dernières créations et sesnouvelles extravagances. Une soirée qui s’annonce pleine de surprises et réserve de bons moments, car avec la tornade rouge, la monotonie et l’ennui  n’ont pas leur place! Avis aux amateurs.# « Fais le mouv party »au Casc PK0. Encore un évènement dédié à la jeunesse et tous les amateurs de musique urbaine. « Fais le mouv party » réunit plusieurs Dj connus et reconnus pour ne citer que Gouty et le fameux Yohann Loîc ainsi que plusieurs artistes : Mem’s family, Jiol’ambups, ou encore Tsota.# Sanda Ranaivosoa au Café de la Gare Soarano. De la bonne musique à volonté ! C’est ce qui sera au menu ce soir. Le répertoire n’a pas été dévoilé. Une chose reste néanmoins sûre, on ne risque pas de s’ennuyer.# Iraimbilanja au Piment Café Behoririka. Certains disent de ce groupe qu’il est dépassé, qu’il est « has been », mais c’est sans savoir, car Iraimbilanja, malgré les années au compteur, est toujours au top de sa forme comme en témoigne chacune de ses prestations. Ce soir, Raimbl sera sur la scène du Piment Café.# Benny, Bebey, Sammy et Sefo à l’espace Nambinintsoa Talatamaty. « Lôlô sy ny tariny » revisité par trois des membres, avec Sefo à la rescousse ! A défaut d’un « Lôlô sy ny tariny » au grand complet, les inconditionnels de ce légendaire groupe de folk devront se contenter des reprises de Benny, Bebey et de Sefo. Ce soir, le trio va investir l’espace Nambinintsoa et revisiter tous ces tubes qui ont fait la renommée de la formation !# « Mijoboka vacances » à Antsahamanitra. Avec sa nouvelle composition « Mijoboka », Jess Flavi One a fait un grand tabac. Sa carrière musicale a connu un nouveau rebondissement. Les organisateurs de « Mijoboka vacances » en ont même fait l’intitulé de leur évènement qui met également à l’affiche, outre Jess Flavi one, Rak’roots, Jiol’ambups, Mr Syda et Malm Martiora.# Farah John’s au Bonara-Be aux 67ha. Il est plus que temps de reprendre les rênes et de se secouer un peu ! Après  plusieurs mois loin de la scène, Farah John’s revient sous les feux des projecteurs. Ce soir, elle donnera ainsi rendez-vous à ses inconditionnels au Bonara-Be 67ha. « Confiance », « Décidé », « Anao tiako »… seront certainement au menu.# Mia et Rija Ramanantoanina au Carlton Anosy. Mia va retrouver ses fans au Carlton pour un concert qui s’annonce plus que passionné. Elle partagera l’affiche avec  Rija Ramanantoanina. Le répertoire pour ce concert ne comportera pas seulement les compositions des deux artistes. Interprète hors pair, le quartet va en effet intégrer à son répertoire, quelques-uns, voire plusieurs des titres de leurs idoles.# Vibe party au Dôme rta Ankorondrano. Fini le stress et la pression des examens, place ce soir à la fête. Les jeunes vont pouvoir retrouver toutes les « stars » actuelles au Dôme rta pourMijah, Tsota, KImjah, Bab’s, Jyuni, Elodie, Jiol’ambups, Andriann et Kougar.Mahetsaka

Midi Madagasikara32 partages

Les chiffres de la semaine

33,80. Le taux de réussite national aux examens du BEPC de cette année. « Un taux relativement faible qui démontrerait la régression du niveau scolaire des élèves malgaches » d’après de nombreux observateurs. Il convient de rappeler que le district de Tsihombe est celui qui a enregistré le taux de réussite le plus élevé lors de ces examens officiels, soit 85,45 % de candidats admis. Par ailleurs, le district de Benenitra affiche le plus faible taux de réussite avec 4,72%.

1 649. Le nombre de prisonniers détenus en détention préventive dans la prison d’Antanimora. Un chiffre qui constitue à peu près la moitié des détenus au sein de ladite prison qui s’élève à 3 297 d’après les dernières statistiques en date du 30 juin 2017. Une surpopulation carcérale apparente étant donné que la prison aurait été créée pour environ 1 700 prisonniers.  

5. Le nombre d’années d’emprisonnement avec sursis qu’a écopé le militant écologiste Clovis Razafimalala et coordinateur de la coalition Lampogno. Un groupe qui milite contre les trafics illicites des ressources naturelles. Clovis Razafimalala a toutefois été emprisonné durant dix mois avant d’être libéré lors de son jugement le 24 juillet dernier.

José Belalahy

Midi Madagasikara31 partages

Musique: Farakely prépare la sortie de son premier album

Farakely veut partager son premier album.

En quelques années, Farakely a su s’imposer dans le monde de la variété locale. Surtout connue comme étant une des membres du groupe Randrantelo, elle a depuis tracé son chemin. Et comme surprise, elle a secrètement préparé son premier album qu’elle présentera lors du concert de promotion qui se tiendra au CC Esca le 18 août prochain.

 

Connue comme étant l’une des trois filles de Randrantelo, Farakely a marqué le public au sein de ce groupe et avec le duo qu’elle a monté avec son frère Laza. Sa voix, son timbre et son charme n’ont pas laissé le public de marbre, Farakely a démarré sa carrière plutôt calmement. En réalité, cela fait des années que Farakely chante. « Quand nous étions petits, nos parents nous avaient initiés à la musique. Moi, j’avais 9 ou 10 ans et franchement, cela ne m’intéressait pas du tout. Ce n’est que plus tard, lorsque j’ai rejoint une chorale, que j’ai commencé à apprécier la musique, et à comprendre tout l’intérêt de jouer de la musique » raconte Farakely. Depuis, elle ne peut plus se passer de musique. Elle participe à un concours avec son frère, mais c’est plutôt le groupe Randrantelo qui lui servira de tremplin pour se      faire connaître du grand public. Avec Randrantelo, j’ai tout appris. Et j’y ai connu plusieurs expériences qui m’ont mûrie. Aujourd’hui, même si les membres se sont éparpillés, le groupe Randrantelo existe toujours et Farakely souligne qu’elle fait encore partie du groupe.

« Tafaray isika roa ». « Si dans le groupe Randrantelo, nous avonsplus l’habitude de faire des interprétations, même si nous jouonsparfois nos propres chansons dans le répertoire, mon véritable objectif est de créer, de composer et de sortir mes propres chansons » dit-elle… Car Farakely ne l’a pas dit à tout le monde, mais cela fait quelque temps qu’elle se met à créer ses propres chansons. Elle a même déjà tout enregistré en studio, et veut le partager au grand public. Un album en solo pour révéler ses inspirations, car Farakely veut donner un coup de jeune à son style et imposer sa propre couleur. Tout est déjà fin prêt, et la chanteuse attend le grand moment pour présenter cet album intitulé « Tafaray isika roa », lors du concert de promotion qu’elle donnera le 18 août prochain au CC Esca Antanimena. On n’en attend plus que vous !

 

Anjara Rasoanaivo   

Tia Tanindranaza30 partages

Carolie Gevers- Banky iraisampirenenaTena mahantra ny Malagasy

Miisa valo ireo singa nalaina tamin’ny PND (PaikadyNataoDinasa) hisitraka tohana ara-teknika sy ara-bola avy amin’ny Banky iraisampirenena voarafitra ao anatin’ny CPP (Cadre de Partenariat Pays) amin’iMadagasikara, hoy ny tale misahanaan’i Madagasikara Coralie Gevers.

 

 Voakasik’izany,ohatra,ny tetikasa rafi-panabeazana (PSE), nysehatry ny sakafo ara-pahasalamana (ONN) na koa ny fanohanana ny tetibolam-panjakana. Teboka fototra niaingana kosa ny fiatrehan’ny vahoaka Malagasy ireo tandindona sosialy sy ekonomika ary tontoloiainanasyfiovan’nytoetrandro. Nomarihanyihanykoa fa tenaambonybenytarehimarikamombanyfahantranaetoMadagasikarasatriany 78%-n’ny Malagasy no tena mahantra fadiranovana, izany hoe miaina amin’ny vola latsakyny 1,90 dolara isan’andro araka ny maridrefyiraisampirenenamoaio.Ary tsy vitan’izay fa ireo olona heverina hoe eo antenatenany na « classe moyenne » dia mbola misy ampahany betsaka azo sokajiana hoe tena sahirana,izany hoe tena maro an’isa be ny Malagasy tena mahantra, hoyRtoa Coralie Gevers.Nomarihany koa anefa fa tsy mampiova ny fifampidinihana efa vita teo amin’nygovernemanta Malagasy sy ny Banky iraisam-pirenena ny fialan’ny minisitry ny fitantanambola Rakotoarimanana Gervais. Mitana ny teny nomeny amin’ny fanampiana ilay 1,3 miliaradolaranandritranyfikaonandohan’ireompamatsysympampiasa vola tany Paris nyvolanadesambra 2016 rahateonyBankyiraisampirenena fa tsymijerynytontolopolitikatoynyfanatontosananyfifidiananaetoMadagasikaraamin’nytaona 2018 rahanandrafitranypaikadylasitrafiaraha-miombon’antoka 2017-2021, arakanyfanamarihany.Hanampynyfanjakana Malagasy amin’nyfanatraranaireotanjon’nyfampandrosoanany CPP (Cadre de Partenariat Pays) hatramin’nytaona 2021 nyBankyiraisam-pirenena ;hahena 1% isan-taona,ohatra,nytaham-pahatarana ara-pitomboanaambonybeamin’nytsyfanjarian-tsakafomitarazoka hoan’ireoankizylatsakyny 5 taonaetoMadagasikara.

 

Ramano F.

 

 

Midi Madagasikara30 partages

Manandafy Rakotonirina Contre Constant Raveloson

Le parti MFM a sorti un communiqué, suite à la déclaration de Constant Raveloson. Ledit communiqué informe notamment que l’ancien coordinateur de ce parti dans la région Analamanga ne devrait plus parler au nom du MFM. Il a été remplacé par Etienne Rakotoarimanana. Le communiqué a été signé par Manandafy Rakotonirina. Une réplique de ce dernier à son ancien bras droit. Visiblement le courant ne passe plus entre Manandafy Rakotonirina et Constant Raveloson, pourtant, ils ont partagé les mêmes idées pendant plus de 40 ans. La prise de position de cet ancien animateur de service des meetings des « Zanak’i Dada » au Magro Behoririka, vis-à-vis du parti présidentiel, n’a-t-il pas plu au fondateur du MFM ? Toujours est-il que Constant Raveloson a qualifié le HVM d’avoir tendance à mettre en place un Parti-Etat.    

Recueillis par Dominique R.      

Midi Madagasikara29 partages

Antsohihy – Sambava: Jiolahy roa avy nanafika matin’ny fokonolona

Na dia eo aza ny fanentanana ataon’ireo mpitandro filaminana mahakasika ity resaka fitsaram-bahoaka ity dia mbola tsy tena lefy tanteraka izany. Ny voalohandohan’ny herinandro teo dia jiolahy roa avy nanafika no nifanehatra tamin’ny fokonolona. Tsy nanan’ireo farany antra izy ireo ka niafara hatramin’ny famoizan’ny ainy. Tany Ambatomasina, kaominina Antsahavoribe, distrikan’i Sambava ny voalohanay. Araka ny fampitam-baovao azo dia olona roa nisaron-tava, nitondra basy poleta no nanafika tokatrano iray. Tsy nahazo n’inona n’inona izy ireo fa nalaky niantso vonjy ny tompon-trano. Niara-nientana avy hatrany ireo mponina teo amin’ny manodidina namonjy ity voatafika. Tamin’izay no nifanena tamin’ireto olon-dratsy. Voasambotr’izy ireo ny iray raha tafaporitsaka ny namany. Tsy nanao inona teo ambany fahatezeran’ireo fokonolona ity olon-dratsy voasambotra. Niainga ny daroka sy ny vono ary tsy namelan’ireo nahatratra raha tsy niafara tamin’ny fahatesany izany. Efa nampandrenesina mo ireo zandary tany an-toerana ary efa am-panaovana ny fanadihadiana sy ny fikarohana ilay iray nitsoaka. Fa tany Antsohihy ihany koa, dahalo avy nanafika tao amin’ny tananan’i Marosampanana no nifanenjehan’ireo mpanara-dia izay nahitàna zandary sy fokonolona. Tratra ny iray tamin’izy ireo ary dia tsy namelan’ireto fokonolona raha tsy nanaraka hatramin’ny ainy. Efa tafaverina kosa ny omby nangalarin’izy ireo. Mbola mitohy kosa ny fikarohana ireo naman’ireo dahalo tafatsoaka.

m.L

Midi Madagasikara28 partages

Morombe: Lehilahy nandidy ny tendany tamin’ny antsy maranitra

Lehilahy iray manodidina ny 35 taona eo,  no maty tsy tra-drano nandidy ny tendany tamin’ny antsy maranitra, omaly antoandro tokony ho tamin’ny 11 ora, tany Antanimeva Distrikan’i Morombe. Hatreto sahiran-tsaina ny fianakaviany, fa tsy fantatra mazava ny antony nanosika an’ity lehilahy ity nanapitra ny ainy rehefa nihidy irery tao an’efitrano fandriany. Rehefa nisaraka tamin’ny vadiny ity lehilahy namoy ny ainy, izay voalaza fa tratran’ny aretin-tsaina hafahafa toa ambalavelona, satria misy fotoana midelira tampoka izy, ary milaza fa misy olona maro be manenjika azy, dia niverina nipetraka tany amin’ny ray aman-dreniny ny faramparan’ny volana jona teo. Gaga ny anabaviny omaly, fa hatry ny naraina ity anadahiny no tsy hitany, ka rehefa nojereny tao amin’ny efitra fatoriany, dia ankona ity anabaviny avy teo nikiakiaka mafy nahita ny vatana mangatsiakan’ny anadahiny nihosin-drà tsy nisy aina intsony nivalampatra teo ambony fandriana, ary mbola hita teo ny antsy maranitra nandidiany ny tendany, hoy ny tati-baovao voaray.

Eric Manitrisa

Midi Madagasikara27 partages

Toamasina: Elysée Ratsiraka auditionné pendant quatre heures par la police

Le maire de Toamasina Elysée Ratsiraka a été auditionné pendant quatre heures (de 10h à 14h), hier, par la police de ladite localité. Il est inculpé notamment de détournement de deniers publics et de cession illégale de terrain dans la commune urbaine de Toamasina. Ce sont les conseillers municipaux qui ont déposé une plainte auprès du Parquet de Toamasina et du Bianco. Notons que d’autres personnes ont été également auditionnées, la semaine dernière. Il s’agit du directeur technique et du directeur du Budget. Faut-il rappeler que les relations entre le maire de Toamasina et les conseillers municipaux ont toujours été tendues, depuis un certain temps.

Recueillis par Dominique R.   

Midi Madagasikara25 partages

Jeux de la Francophonie Aicha Isilo remporte le bronze en judo

Fin de parcours pour les sportifs malgaches engagés aux 8es Jeux de la Francophonie à Abidjan.

La délégation sportive malgache rentre au pays avec trois médailles d’argent de la lutteuse Emma Rasoanantenaina et deux bronze des judokates Diana Kwan Hu et Aicha Isolo. Une dernière journée qui a souri au judo malgache. Ils étaient trois judokas en compétition hier au Palais des Sports de Triechville. La dernière à entrer sur le tatami, Aicha Isolo dans la catégorie des plus de 78 kg malgré sa  défaite par ippon face à la Congolaise, Imongo Kimberly lors du premier combat, elle arrive à se qualifier pour la finale de bronze. Face à la Congolaise, Loko Mapela, elle a remporté le bronze et offre la deuxième médaille du judo. Chez les moins de 90kg, Mahandry Randriambelo a été battu par Alex Colpits du Canada Québec sur ippon en 2 mn 35 de combat. Même chose pour Haingo Randriamiarisoa chez les moins de 78kg qui s’est inclinée par ippon face à Njepang Njapa du Cameroun juste après 30 sec de combat. Elle s’est pourtant qualifiée pour la finale de bronze, mais a perdu contre la Tunisienne Sarra.

En athlétisme en finale du 1 500 m, Donné Efanomezantsoa a terminé 8e et dernier en bouclant la course en 4 mn 02 sec 72. Cette finale a été dominée par le Maroc qui a raflé toutes les médailles. Elkaam a remporté la médaille d’or avec un chrono de 3mn 46 sec 42. Pour la finale du relais 4×400 m, le quatuor malgache finit la course à la cinquième place. La bande à Todisoa, Bezara, Lucas et Tahiana a signé un temps de 3 min 15 sec 88. Pourtant, Todisoa a bien démarré la course en terminant 3e du premier relais, mais les Canadiens et les Français ont dépassé les Malgaches au 3e relais. C’est la Suisse qui s’est emparée de la médaille d’or devant le Sénégal et la France. Autant dire que les athlètes malgaches ont du potentiel, mais le gabarit fait défaut. L’athlétisme malgache a besoin d’athlètes imposants physiquement pour mieux s’aligner aux autres pays.

 T.H

Tia Tanindranaza20 partages

Fanodinkodinam-bolaNohadihadiana i Elysé Ratsiraka

Ora efatra no lanin’ireo polisy avy amin’ny kaomisaria misahana ny heloka ara-bola Toamasina, nanaovana ny fakana am-bavany an’ny ben’ny tanàna tao amin’ny lapan’ny tanànan’i Toamasina omaly.

 Polisy telo nahitana “officier” iray mpitarika ny fanadihadiana sy inspektera mpanao ny fakana am-bavany, ary “brigadier en chef” mpandray an-tsoratra ny zava-misy izy ireo, izay natrehan’ny mpisolovava mpisolo toerana iray ihany koa. Raha ny angom-baovao marim-pototra dia ilay resaka tany izay ny ben’ny tanàna no mpividy ary izy ihany no mpivarotra, izy koa no mpanome alalana tamin’ny fanaovana sonia sy ilay volana solika mivoaka eo anivon’ny kaominina tsy tonga amin’ny tompony, ny karaman’ny mpiasa mivoaka avy eny amin’ny “trésor” nefa tsy tonga amin’ny mpiasa voasoratra anarana no heloka nakana am-bavany azy. Efa ho telo volana ity raharaha ity izao no tonga teny amin’ny polisy misahana ny heloka ara-bola Toamasina raha nalefan’ny tonia mpampanoa lalàna hanaovana fanadiadiana lalina. Tao anatin’izay anefa dia tsy namaly ny fiantsoana azy ny ben’ny tanàna noho ny tsy fananany fotoana sy ny fahasahiranany lava. Tamin’izao fakana am-bavany izao dia izy ihany no nanome ny fotoana alakamisy nanaovana ny fanadihadiana. Nilamina ny fakana am-bavany azy. Ny nanaitra ny mpanao gazety dia ny fanaovan’ireo polisy nanao izany sy ny mpisolovava mpisolo toerana lalam-poza niafina ny mpanao gazety, ka nivoaka tany an-damosin’ny lapan’ny tanàna tsy nivoaka ny varavarambe nidiran’izy ireo tamin’ny voalohany. Ny ben’ny tanàna aza nanao tari-dositra ny mpanao gazety taorian’ny fivoahany ny birao fiasany. Raha ny fanazavana dia miankina amin’ny tonia mpampanoa lalàna ny ho tohin’ny fanadihadiana na tsia.

 Rakoutou

Midi Madagasikara18 partages

Anjozorobe: Fanafihan-dahalo roa tao anatin’ny iray andro

Azo lazaina fa tsy mandry ny tany ao Anjozorobe ao. Mirongatra ny halatr’omby ary mahatratra am-polony ireo jiolahy no manafika, toy ity nitranga tao amin’ny kaominina Androvakely, ny alin’ny 25 jolay ity. Araka ny fampitam-baovao avy tamin’ny zandarimariam-pirenena, dahalo 20 lahy nitondra basim-borona sy zava-maranitra no nanafika tao amin’ny tanàna antsoina hoe Andranonahoatra, tokony tamin’ny 8 ora alina. Nanapoaka basy izy ireo no sady nandroba izay toerana rehetra nisy omby tao. Misy Nandre izany ireo miaramilan’ny  DAS tao an-toerana, dia nanapoaka basy ihany koa ka vaky nandositra ireo jiolahy miaraka amin’ny omby 18 ka nizotra niatsinanana ny dian’izy ireo. Soa fa tsy nisy ny naratra na maty.

Ora vitsy taorian’io ihany  tokony ho tamin’ny 11 ora alina. Dahalo 4 no nanafika tao Ambohidava, fokontany sy kaominina Amboasary. Nitora-bato izy ireo ary kaboda na kobay no fitaovana nentiny. Lasa tamin’izany ny omby 7 an-dRakotondrazafy Charles sy Razafiarimanana Helène ary Rakotovelo Jean izay samy monina ao Ambohidava. Olona iray no naratra voavelin’ny kaboda izay mponina ao an-toerana ihany. Nandeha

nizotra nihazo an’Ambohibary Vohilena ny dian’omby. Efa mandray an-tànana ny raharaha ny zandary sy ny miaramilan’ny DAS any an-toerana.

T.M.

Midi Madagasikara17 partages

Plateforme pour l’Emergence de Madagascar: Non aux baux emphytéotiques !

Holijaona Raboana de la Plateforme pour l’Emergence de Madagascar. (Photo d’archives)

La Plateforme pour l’Emergence de Madagascar condamne les propos du chef de l’Etat, Hery Rajaonarimampianina, lors de la 12e édition de l’émission « Rendez-vous du Président ». En effet, et ce, à titre de rappel, le chef de l’Etat avait affirmé qu’ « il est strictement interdit de vendre des terrains aux étrangers. On ne peut recourir qu’aux baux emphytéotiques ». Mais cela est loin de ravir la Plateforme pour l’Emergence de Madagascar et certainement, la plupart des Malgaches dans la mesure où un bail emphytéotique peut durer jusqu’à 99 ans. Et justement, louer un terrain pendant 99 années est synonyme de sa vente médiate. Par voie de conséquence, ce n’est ni une option ni une solution. « Nous pouvons très bien obtenir des avantages des étrangers sans recourir aux baux emphytéotiques. Par exemple, coopérer suivant la règle des 3G ou Gagnant-Gagnant-Gagnant comme le font actuellement les pays émergents », indique Holijaona Raboana sur le réseau social Facebook.

Crises. Par ailleurs, la Plateforme pour l’Emergence de Madagascar rappelle également à quel point les Malgaches s’attachent aux terres. Et la preuve : l’éviction de Marc Ravalomanana en 2009 dans l’affaire Daewoo Corporation. Il en est de même pour le cas de Soamahamanina. En d’autres termes, cette plateforme anticipe et propose l’application du projet de société qu’elle a élaboré : le Pacte pour l’Emergence de Madagascar. « Nous voulons tous la stabilité politique et la paix pour que Madagascar puisse démarrer le développement. Nous incitons donc les dirigeants actuels à appliquer à bon escient ce pacte, car le fait d’approuver les baux emphytéotiques ne fera qu’accentuer les problèmes », conclut-il.

Recueillis par Aina Bovel

Midi Madagasikara17 partages

Forum Japon-Afrique: La politique agricole mise en avant pour Madagascar

« Agriculture and Agribusiness: Enhancing the Food Value Chain in Africa ». C’est le thème de la présentation du Secrétaire d’Etat chargé de la Coopération et du Développement, auprès du ministère des Affaires étrangères, Bary Rafatrolaza, lors du Forum Japon-Afrique qui s’est tenu le 25 juillet dernier. « Dans la vision du Gouvernement, Madagascar en 2025, s’appuie sur une production agricole compétitive et durable, intégrant des exploitations familiales et des unités de transformation modernisées pour assurer la sécurité alimentaire et conquérir les marchés d’exportation », a-t-il indiqué. En effet, il s’agit de faire de l’agrobusiness un levier important du développement.

Diversification. D’après les explications du secrétaire d’Etat, la politique actuelle poursuit  une approche qui allie à la fois l’appui aux petits exploitants agricoles pour aller vers la modernisation et la promotion de grandes exploitations intensives et des unités de transformation qui seront concentrées dans les ZIA.  En outre, dans un souci de promotion du partenariat gagnant-gagnant, le gouvernement malgache a misé et encouragé la pratique de l’agriculture contractuelle. Cette approche permet aux producteurs de trouver des débouchés pour leurs produits, tout en respectant les qualités définies dans le contrat, mais profite également aux grandes entreprises qui ont la garantie d’un approvisionnement sûr et continu.  D’autre part, Madagascar  ambitionne de devenir le « Grenier alimentaire de l’Océan Indien », avec l’adhésion et l’appui de plusieurs partenaires techniques et financiers. Profitant de cette rencontre internationale, le secrétaire d’Etat a sollicité l’engagement des investisseurs Japonais et autres, à entreprendre à Madagascar.

 

Antsa R.

L'express de Madagascar16 partages

Basketball - Analamanga – Place aux demi-finales

Les éliminatoires des cham­pionnats d’Analamanga de basketball catégories U12, U14 et vétérans ont pris fin hier. Place aux demi-finales ce jour au gymnase couvert de Mahamasina.Les quarts de finale des U12 ont eu lieu mercredi et ceux des U14 hier. Les demies des filles U12 ouvrent la journée ce vendredi, JCBA rencontrera 1SF en ouverture et suivi du duel MB2ALL contre TSBB. Du côté des garçons, Fandrefiala affrontera BCSM et DTSC sera opposé à BCMA. El les demi-finales des U14 garçons et filles s’étaleront l’après-midi.« On a décidé d’annuler tous les matches prévus pour ce samedi vu la manifestation politique en gestation, dans le cadre de la célébration du quinzième anniversaire du parti TIM au stade de Mahamasina», a avisé un des dirigeants de la ligue régionale d’Anala­manga de basketball. Tous les participants seront donc en repos demain et les finales des trois catégories ainsi que la phase finale du cham­pionnat de basket virtuel 2K17 sur PS4 à partir des quarts de finale auront lieu dimanche.

S.R.

Tia Tanindranaza15 partages

Apostoly Marc TatandrazaTsy hanao politika mandrakizay aho

Taorian’ny nanaovan’ny Apostoly Marc Tatandraza fanambarana goavam-be fa tsy maintsy handeha hody any amin’ny Ray izy dia betsaka ny resaka nandeha momba azy.

 

Pati

 

Midi Madagasikara14 partages

Affaire Assist Développement – Ambatovy : Une anomalie judiciaire qui ternit l’image de l’environne...

L’affaire Assist Développement contre Ambatovy continue de faire des vagues. Une affaire suivie de près par les hautes instances du pays, tout simplement parce qu’elle concerne ce que l’on appelle dans le milieu économique, le plus grand investissement  minier jamais réalisé dans le pays qu’est le projet Ambatovy. Un projet qui génère des centaines de millions de dollars de devises et des milliers d’emplois directs et indirects. Mais qui, malheureusement est menacé, non seulement par la chute des cours du nickel, mais également par les bizarreries judicaires qui ont cours actuellement.

 

En effet, dans cette affaire, la juridiction de Toamasina a persisté à statuer. Et ce, malgré l’existence d’une clause de recours à l’arbitrage international dans les contrats liant Assist Développement et  DMSA. En tout cas, de forcing en forcing, l’affaire en est actuellement au point où  Ambatovy fait l’objet de procédure de saisie de ses comptes et de ses biens. Un acharnement qui va provoquer l’agacement des investisseurs locaux et internationaux. « C’est ce genre d’anomalie judiciaire qui  ternit l’image de Madagascar auprès des détenteurs de capitaux et les promoteurs de grands projets » fait-on notamment remarquer dans le milieu des affaires. Et quand on sait que l’affaire fait des échos même dans le milieu diplomatique, il est plus que jamais nécessaire de mettre un terme à cette mauvaise pratique judiciaire.

 

R.Edmond.

Midi Madagasikara13 partages

Région Analamanga: Sept motos pour la gendarmerie nationale

Face à la recrudescence de l’insécurité, la région Analamanga va prêter main forte à la gendarmerie nationale. A cet effet, le chef de région Analamanga Ndranto Rakotonanahary a doté les bérets noirs de ce « Faritra » de sept motos. La cérémonie s’est déroulée, hier, à Ankadilalana et ce, en présence du général Andrianjanaka Njatoarisoa, commandant de la circonscription interrégionale de la gendarmerie nationale (CIRGN), d’Antananarivo. Ces motos vont servir notamment à surveiller la circulation des voitures dans la région Analamanga. Par ailleurs, le colonel Ravoavy Zafisambatra a lancé un appel à tout un chacun d’informer les forces de l’ordre, en temps réel.

Recueillis par Dominique R.

Midi Madagasikara12 partages

Is’Art Galerie: Tolotra Ramboasolo « imprime sa lumière »

C’était hier. Le vernissage de l’expo « Imprimer la lumière » de Ramboasolo Tiana Tolotra a permis au public de découvrir son style et ses clichés. Une deuxième exposition après « Langage du corps » en 2015, qui reflète les inspirations de l’artiste. « L’idée de cette expo m’est venue en discutant avec d’autres amis photographes, il y a un an de cela. «  Imprimer la lumière » c’est la base même de la photo, alors je voulais mélanger le nu féminin et la projection de lumière sur le corps » explique-t-il. Les photos de femmes nues sont alléchantes, mais loin d’être vulgaires, car dans ses œuvres, Tolotra utilise le corps de la femme comme support et non comme sujet. D’ailleurs, avec ce jeu de lumière entre clair-obscur, le corps de la femme est sublimé et devient une vraie poésie. « La technique utilisée est la photographie et la projection proprement dite » dit-il..Car Tolotra a fait de ces photos qui jouent de la lumière sa signature. « Je suis tombé dans la photo inopinément, mais heureusement » raconte Tolotra. C’était en 2009 alors qu’il a tout appris de Toky Andrianjafitsara. Depuis, il se spécialise dans les photos de spectacles et les photos de nuit et a développé ses techniques en matière de photoreportage et photo studio.

Anjara Rasoanaivo

News Mada8 partages

Madagascar – Banque Mondiale: un nouveau Cadre de partenariat pays

Le nouveau Cadre de partenariat pays (CPP) de la Banque mondiale avec la République de Madagascar a été présenté officiellement hier. Le document approuvé par son Conseil d’administration le 27 juin dernier, définit la stratégie du groupe de la Banque mondiale à Madagascar pour la période 2017-2021.

Le groupe de la Banque mondiale s’engage à investir 1.3 milliard de dollars avec l’Etat malgache, comme annoncé lors de la Conférence des bailleurs de fonds et des investisseurs en décembre dernier à Paris. La mobilisation de ce fonds devrait servir à soutenir des réformes et permettre des interventions à impact élevé dans les domaines du développement humain, de l’agriculture résiliente, de l’inclusion financière et de l’énergie. Le nouveau CPP repose sur des priorités définies en étroite concertation avec les acteurs concernés.

Elaboré en consultation avec le Gouvernement et d’autres parties prenantes et aligné sur le Plan national de développement (PND), le CPP vise à aider Madagascar à accroître la résilience des personnes les plus vulnérables (78% de la population vivent avec moins de 1,90 dollars par jour), à favoriser une croissance inclusive et à mobiliser d’importants investissements privés pour le développement, tout en renforçant les institutions nationales et locales afin de réduire la fragilité.

Renforcer la résilience

«Ce n’est pas un hasard si ce CPP cherche en premier à renforcer la résilience de la population malgache face aux risques socio-économiques, environnementaux et climatiques», a expliqué Coralie Gevers, représentante de la Banque mondiale à Madagascar, à l’occasion de cette présentation, hier, à Anosy.

«Pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises», a-t-elle ajouté.

Le CPP cherche à aider le Gouvernement à atteindre des objectifs de développement concrets. D’ici à 2021, les objectifs principaux sont de réduire de 1 point de pourcentage par an le retard de croissance chez les enfants de moins de cinq ans dans les régions où les taux de malnutrition chronique sont les plus élevés. Ce cadre vise aussi à augmenter de 25% le nombre d’enfants atteignant la dernière année de l’école primaire à travers le pays et de doubler le taux d’accès à l’électricité.

Deux piliers fondamentaux

«Ce cadre de partenariat est une réponse à nos priorités et affiche en toile de fond la lutte contre la pauvreté. Nous avons relevé deux piliers fondamentaux : la réduction de la vulnérabilité à travers la prise en charge d’une plus grande résilience et la nécessité de disposer d’une croissance plus inclusive et durable. Ces deux piliers confortent notre vision de développement qui était déjà prédéfinie dans le cadre du PND», a indiqué le général Herilanto Raveloharison, ministre de l’Economie et du plan.

«Ce cadre de partenariat nous permet de jouir pleinement des instruments de financement de la banque (IFC, Ida, Miga) qui profitent bien sûr à l’Etat mais également au secteur privé», a-t-il conclu.

Les financements Ida de la Banque mondiale à Madagascar sont fortement concessionnels : 50% sont sous forme de dons, 50% sont en prêts sans intérêt sur une durée de 38 ans, avec une période de grâce de 6 ans.

Arh.

Midi Madagasikara8 partages

Exposition: « Jeux d’inspiration » ou l’exposition cinq en un !

Une des œuvres exposées au Louvre dans le cadre de « Jeux d’inspirations »photo : Kelly0

Ce qui inspire l’un n’anime pas forcément l’autre. Et si   les uns se spécialisent dans le portrait, d’autres valorisent les paysages. Jusqu’au 30 juillet, cinq peintres, venus de divers horizons donnent une exposition commune au Louvre Antaninarenina. Se réunir pour mieux se mettre en avant ! C’est le concept de cette exposition inédite au Louvre Antaninarenina qui réunit cinq peintres évoluant dans divers horizons. Utilisant diverses techniques et mettant en valeur différents thèmes, Razafimbelo Naivo Haja, D’Ange Rambelo, Andriantsilavo Toky Andriamisaina, Rodolphe Ranaivoarimanana et Andrianaivo Mahenina ont pourtant choisi de tenir une exposition commune. « L’idée est de Dolphe. Il nous a sollicités pour exposer avec lui. Le but de cette collaboration : donner une plateforme aux artistes comme nous qui n’avons pas de galerie pour présenter nos œuvres,  mais surtout, d’offrir aux amateurs et aux visiteurs toute une multitude de choix possibles, tant dans les techniques que dans les dessins », explique Toky Andriantsilavo.

Une centaine. Pour cette exposition, une centaine de tableaux orne donc les cimaises du Louvre Antaninarenina. Ceux de Mahenina mettent en scène la vie des Malgaches, des toiles plus dans l’ère du temps. D’Ange est plus axé sur les paysages. Rodolphe ? Il utilise une technique atypique et plutôt originale. « Il utilise toujours l’huile, mais a choisi comme support l’écorce de banane ». Pour sa part, Toky Andriantsilavo s’inspire des images d’archives empruntées à l’ANTA (Agence nationale d’informations Taratra). « Ma spécialité, ce sont les portraits. Je dessine des visages, pas seulement de personnes originaires de la Capitale, mais de tout Madagascar. Pour cette exposition ‘Jeux d’inspiration’, je me suis inspiré d’images représentatives de personnes venues de différentes régions ». « Jeux d’inspiration » est visible au Louvre Antaninarenina jusqu’au 30 juillet.Mahetsaka

Midi Madagasikara7 partages

VOLLEY-BALL: Le sommet national à Toamasina du 3 au 17 septembre

La fédération a débuté sa saison avec des formations d’entraîneurs que ce soit en beach volley ou en volley et cela sera suivi par les jeux de la CJSOI à La Réunion. Et surtout, il y a l’annonce des championnats de Madagascar U18, U20 et seniors à Toamasina.

« La saison a débuté avec les formations de niveau II et du Beach volley. On entame les jeux de la CJSOI à la Réunion pour les dames de moins de 18 ans » a annoncé le président de la fédération, Andriamandimbisoa Jocelyn. A la demande de Madagascar et de la Réunion, le volley continue donc dans les jeux de la CJSOI. La fédération française donnera un coup de main quant à l’organisation. Côté malgache, la sélection est là avec dix jeunes filles alignées par des coaches et validées par les entraîneurs nationaux. Ces jeux auront lieu du 1er  au 5 août 2017 à la Réunion. « Il n’y a pas eu de regroupement ni de présélection » , a déclaré le président. « La sélection africaine est la base. Nous y avons mis de très grandes joueuses en plus. On n’a pas eu de financement pour la présélection. Nous organisons pour elles des séances d’entraînement intense à Mahamasina ou à Ankorondrano. On fait des appuis personnalisés surtout ».  Toujours selon lui, les moins de 18 ans filles et garçons seront en lice aux jeux des jeunes en Algérie en juillet 2018 et le sommet national de Toamasina servira aussi de détection. De même, il y aura du Beach-volley à ces jeux de jeunes.   

Pour revenir au sommet national, il aura lieu du 3 au 17 septembre à Toamasina pour les moins de 18 ans, les moins de 20 ans et les seniors. « Nous avons fait une consultation tournante pour décider de l’endroit. Toamasina s’est présenté, car ils ont des partenaires pour l’organisation avec eux ».

Anny Andrianaivonirina

Midi Madagasikara7 partages

Droit du travail « Les relations individuelles de travail », 3e édition

Dans le cadre du respect du Droit du Travail, Madagascar a ratifié bon nombre de conventions internationales, pourtant : « leur application et leur mise en vigeur demeurent relatives à Madagascar », selon Mme Ralambondrainy Rakotobe Nelly, Premier Président honoraire de la Cour suprême.

En matière de droits du travail, l’importance des normes internationales et de toutes les problématiques qu’elles suscitent dans le règlement des litiges internes va en grandissant. Cette importance croissante incite à réfléchir sur ses problématiques nouvelles dans le but d’entrevoir des solutions pratiques, qui ne seraient ni désuètes ni hermétiques sur le plan social. C’est dans cet esprit qu’est né l’ouvrage « Les relations individuelles de Travail », qui en est actuellement à sa troisième édition ; les deux premières éditions datant respectivement de 2005 et de 2011. La dernière édition a été sortie officiellement hier, écrite et élaborée conjointement par Nelly Rakotobe Ralambondrainy, Premier Président honoraire de la Cour suprême et Ignace Rakoto, historien du Droit, ancien ministre et membre titulaire de l’Académie malgache. Cette troisième édition, étoffée et fournie, a le mérite de tenir compte du caractère évolutif du Droit du Travail et de l’écart entre la promulgation des lois afférentes, leur mise en vigueur et leur application.

Objectifs. L’ouvrage voudrait notamment apporter sa part à l’édification d’un véritable « dialogue social » tout en constituant une source fiable d’informations pour tous les concernés, allant des étudiants, des magistrats et des avocats, en passant par les patrons et travailleurs et même les législateurs. Interrogée sur la notion de « dialogue social », Nelly Rakotobe R. répond : « Rendu possible grâce à l’entité « Comité des Entreprises », il s’agit d’un réel dialogue entre les employés et leurs travailleurs pour mieux anticiper, arbitrer et résoudre les litiges… Et surtout pour la promotion d’un travail qui soit réellement décent, facteur de bien-être pour les travailleurs et leurs familles. » En théorie, cela se tient parfaitement, mais dans la pratique, c’est peu évident : le « Comité des Entreprises », peu le connaissent et peu s’en souviennent ! D’où la promotion du travail décent et non-discriminatoire qui figure entre autres, parmi les objectifs de l’ouvrage « Les relations individuelles de Travail ». Pour ce faire, le manuel traite de plusieurs points : les licenciements discriminatoires, le travail des porteurs de handicap, le travailleur domestique dont la problématique du travailleur migrant et le principe de l’application des normes internationales de travail par le juge national, etc. Et la liste est loin d’être exhaustive ! Notons que l’Organisation International du Travail a collaboré dans la réalisation de l’ouvrage, vendu à 60 000Ar lors du lancement hier, mais disponible au prix de 70 000 Ar dans les Librairies Tsipika et consultable à la Bibliothèque de la Faculté des Droits. Lors du cocktail, Mme Nelly Rakotobe R. s’est même pliée à une séance de dédicaces !

Luz R.R

L'express de Madagascar5 partages

Football - Transfert – Ando portera le numéro 21 à l’USSM

Le transfert d’Ando Manoelantsoa à l’US Sainte-Marienne est définitivement acté. Le milieu de terrain de Barea de Madagascar vient tout juste de s’installer à La Réunion. Sur une photo postée mercredi soir sur le réseau social Facebook, on aperçoit le frère cadet de Lalaina « Bôlida » Nomenjanahary avec son nouveau maillot, floqué du numéro 21.Âgé actuellement de vingt-six ans, le désormais ancien joueur de l’Ajesaia se lance donc un nouveau défi dans le championnat réunionnais. Championnat qui en est actuellement à sa deuxième journée, où l’USSM occupe la quatrième place du classement général, avec un bilan de deux victoires, derrière Petite-île, Excelsior et Saint-Pierroise.À l’US Sainte-Marienne, le capitaine de la sélection malgache en CHAN retrou­vera plusieurs de ses compatriotes, tels que Fabrice Rakotondrabe, ancien de Tana Formation, et Henry Charles Gladyson, ancien d’Elgeco Plus. Ce qui devrait faciliter grandement son adaptation et son intégration au sein de l’effectif du club.

H.L.R.

Madagascar Tribune4 partages

Reconstructions d’Epp et Ceg 5 mois après

Cinq (5) mois se sont écoulés après le passage du terrible cyclone Enawo qui a fait des ravages dans toute la Grande île, du nord au sud. Après cinq mois, on en oublie presque son existence sauf que le ministère de l’Education nationale est là pour nous le rappeler. En effet, ce n’est que maintenant que le ministère procède à la reconstruction des bâtiments des Epp et Ceg dans certaines localités comme dans le district de Moramanga, région Alaotra-mangoro. Le ministre de l’Education nationale s’est déplacé sur place afin de constater les dégâts ainsi que les travaux à faire. Un déplacement bien accueilli par les responsables et enseignants locaux qui ne s’attendaient sans doute plus à quoi que ce soit de la part de l’Etat, 5 mois après le désastre. La question se pose alors de savoir où et comment les écoliers touchés par la destruction de leurs salles de classe ont fait depuis tout ce temps. Surtout ceux qui devaient passer les examens officiels cette année. La lenteur des prises de décisions de la part des responsables étatiques commence de plus en plus à peser sur la population. Surtout en matière de sécurité et d’éducation.

News Mada4 partages

Guide du week-end

Un aperçu de «Boto radio» de Tovolah

«Dans les années 90, la radio était un moyen important pour diffuser ses œuvres. Actuellement, d’autres médias s’activent massivement pour propager des cultures malgaches d’un niveau assez médiocre. Ainsi, la société et aussi la culture hip hop se sont dévalorisées», a annoncé Tovolah du groupe Karnaz. Ces textes se trouvent donc dans son prochain album intitulé «Boto Radio» qui sera présenté prochainement. Par ailleurs, il donnera un aperçu de cet album, ce soir, à l’Is’art galerie à Ampasinimalo.

La 3e édition de Vibe Party

Pour se défouler après les examens officiels, les soirées djings se multiplient, dont le Vibe Party qui en est à sa troisième édition ce soir, au Dôme RTA Ankorondrano. Au programme, plusieurs artistes sont invités pour animer la salle, à savoir Mijah, Tsota, Kimjah, Babs, Jyunii, Elodie,  Jiolambups, Andriann et Kougar. La soirée continuera en laissant la piste à la danse. Plusieurs DJ assureront l’ambiance, entre autres Dj Didds Deejay, Dj Willy Akdemix, Dj Sniper…

Une soirée de 800 volts avec Tence Mena

Pour clôturer cette semaine, Tence Mena présente une soirée de 800 volts ce soir, au Jao’s Pub Ambohipo. Elle n’a qu’un seul but qui est d’enflammer la scène avec ses titres, tels que «Mipopoka», ou encore «Anao no tegna izy», sans oublier bien sûr son dernier morceau sorti récemment «800 volts».

Kalom-pitia avec Mia et Rija R.

Pour la quatrième fois, les deux chanteurs, Mia et Rija Ramanantoanina, se réuniront sur la scène pour le concert baptisé «Kalom-pitia» ce soir, au Carlton Anosy. A chaque édition, les organisateurs proposent un thème spécial. Après la variété et la danse de salon, cette fois-ci, le genre jazzy et quelques tubes des années 60 et 80 sont au programme. Pour cette édition, le jeune chanteur Mirado sera l’invité d’honneur.

Kambana Metal est de retour

Le groupe Kambana Metal monte rarement sur scène. Ainsi, à chaque prestation, il donne le maximum en interprétant ses meilleurs titres depuis le début de sa carrière. De retour, il donnera un cabaret, ce soir, au restaurant Telozoro à Andrefan’Ambohijanahary. Il a ainsi invité deux artistes durant la soirée, à savoir Iniah et Abass, le guitariste du groupe Apost.

Iraimbilanja au Piment Café

Les vieux loups du rock malgaches donnent rendez-vous à leurs fans, ce soir, au Piment Café. Habitué de la salle, Iraimbilanja assurera la soirée en ajoutant dans son répertoire les anciens morceaux du groupe, tels que «Ilay mosoara», «Tao an-tsekoly» ou encore «Tsindri-mandry».

La phase éliminatoire de Madagascar Next Top Model

Depuis plusieurs mois, Adeb’s agency a organisé un concours de beauté et de mannequinat baptisé «Top Model Madagscar». La première phase éliminatoire s’est déjà tenue, il y a quelques jours. Ce soir se tiendra donc une autre séance dénommée «Soirée pop fashion» qui aura lieu au Chef Avenue Café de la gare à Soarano. Jopra, un styliste international sera donc invité et habillera les candidats. D’autres stylistes tels que Sacha Bam Bam seront aussi de la partie.

Lôlô sy ny tariny, le remake

La semaine dernière, Bebey, Benny, Sefo et Sammy ont déjà donné un cabaret dans la capitale, pour interpréter les titres phares du groupe Lôlô sy ny Tariny. Ce soir, ils seront de nouveau derrière les micros de l’espace Nambinitsoa Talatamaty.

Mijoboka vacances 2017

Après l’effort, le réconfort ! Pour clôturer l’année scolaire, Keys Event propose une soirée pour les jeunes ce soir, à Antsahamanitra. Il a choisi cinq artistes du moment, à savoir, Jess Flavi One, Malm Martiora, Mr Sayda, Rak Roots, Jiol’Ambup’s. Pour renfoncer l’ambiance, Shinchan et Teg seront à l’animation.

Stenny présente «Alitara fiderana be»

Demain, le chanteur évangélique Stenny sera en live à Analamaintso, théâtre de verdure à Analamahitsy, durant un concert baptisé «Alitara fiderana be». Il a ainsi fait appel à un autre groupe pour  cet évènement qu’est Elinah.

Din Rotsaka au Bonara-Be

Din Rotsaka s’est fait rare sur la scène de la capitale ces derniers temps. Et pour satisfaire ses fans, il donnera un cabaret, ce soir, au Bonara-Be à 67Ha. Ayant toujours le rythme dans le sang, le chanteur promet donc de chauffer la salle avec le salegy.

Mahaelo au Kianja Saint Michel Itaosy

Avis à tous les fans du groupe légendaire Mahaleo ! Il donnera un grand concert dénommé «Tadidiko ry zalahy»,  dimanche prochain, au Kianja Saint Michel Itaosy. «Soutenu par THB, ceci est un revy vita bacc», a annoncé l’organisateur. Rappelons que le groupe est encore en pleine célébration de son 45e anniversaire.

News Mada4 partages

Détention préventive abusive: un guide pour la société civile

Un guide pour déceler une forme de détention préventive abusive à la Maison centrale (MC) d’Antanimora à l’intention de la société civile a été publié à l’issue de l’atelier organisé au DLC Anosy par la Fédération internationale de l’Action des chrétiens pour l’abolition de la torture (Fiacat) et l’Action des chrétiens pour l’abolition de la torture (Acat) à Madagascar.

Ce manuel indique les garanties judiciaires du détenu, la procédure pénale et le délai de détention ainsi que les droits des détenus, en particulier les prévenus. A part la société civile et les organisateurs de l’atelier, des représentants de l’administration judiciaire et pénitentiaire ont collaboré conjointement pour la réalisation de ce guide.

Grâce à cet outil, les bénévoles des sociétés civiles qui ont reçu une autorisation pourront intervenir en faisant des visites régulières à la prison d’Antanimora afin de déceler d’éventuelles détentions de prévenus pour des motifs injustifiés, et d’agir en conséquence en faisant transmettre leurs dossiers à des avocats. La réalisation de ce manuel entre dans le cadre du projet de la Fiacat sur les garanties judiciaires du prévenu à la prison d’Antanimora, pour une durée de trois ans.

Sera R

News Mada3 partages

IS’ART Gallerie: le nu artistique se dévoile

Jusqu’au 10 août, à l’Is’art Galerie Ampasanimalo, Tolotra Ramboasolo dévoile le nu artistique dans toute sa splendeur à travers «Imprimer la lumière».

Pour cette exposition, Tolotra a jeté son dévolu sur le corps féminin comme support pour mettre en valeur la lumière.  «La base de la photographie est d’imprimer la lumière sur une surface», argumente-t-il, avant d’enchaîner que «La technique de prise de vue consiste ici à projeter sur le corps, comme support, différents motifs de lumière».

Sur les murs de l’Is’art galerie, une bonne dizaine de clichés d’une rare sensualité en grand format mettent en scène la gent féminine à nu et sa féminité à vif. «Ça reste une question de point de vue, l’art nu ne ressort pas forcément un côté vulgaire et sexuel. Au-delà de ce cliché, l’art du nu est un art à part entière», a-t-il souligné.

Pour la petite histoire, il a fait ses premières armes en 2009 à l’époque où il n’avait pas son propre appareil photo. «Je suis tombé dans la photo inopinément mais heureusement», se remémore-t-il. A ses débuts, son portfolio se composait de scènes de vie quotidienne. Ensuite, il a découvert une passion pour les photos  en clair-obscur. Depuis, il a un penchant pour les photos de spectacle et les photos de nuit.

Joachin Michaël

L'express de Madagascar3 partages

Banque mondiale – La résilience à renforcer

Le document du cadre de partenariat pays de la Banque mondiale avec Madagascar se donne pour objectif de renforcer les bases de développement du pays.

Approuvé depuis un mois, le Cadre de partenariat pays (CPP) de la banque mondiale avec la République de Madagascar a été présenté officiellement, hier, au ministère de l’Économie et du plan à Anosy. Ce programme, synthétisé en un ouvrage d’une soixantaine de pages, a été élaboré après concertation avec les principaux acteurs concernés tout en s’alignant sur le plan national de développement ou PND. À savoir le groupe de la Banque mondiale, les ministères clés ainsi que le secteur privé et la société civile.Destiné à couvrir la période entre cette année en cours jusqu’à l’an 2021, le CPP ambitionne d’être l’un des principaux outils de redressement du système de développement du pays. Visant à accroître la résilience des plus fragiles et des plus vulnérables, ce programme se focalise surtout sur la promotion de la croissance inclusive. Dans la mesure où le terme résilience signifie surtout la capacité d’un système à retrouver sa vitesse de croisière après avoir subi crise et perturbation, le choix de la principale thématique du programme tombe à point nommé pour le cas de la Grande île. « Ce n’est pas un hasard si ce CPP cherche en premier à renforcer la résilience de la population malgache face aux risques socio-économiques », souligne Coralie Gevers, représentante de la Banque mondiale.

À la racineEn effet, afin d’obtenir un système de développement intégrant le concept de croissance inclusive, il est important de reconsi­dérer les réformes directement sur les bases.Sur le plan social, le cadre vise à réduire de 1 point de pourcentage par an le retard de croissance chez les enfants de moins de 5 ans. L’augmen­tation de 25 % du nombre d’enfants atteignant la dernière année de l’école primaire est aussi envisagée. D’un autre côté, l’amélioration du climat des affaires pour les petites et moyennes entreprises tient une place importante dans ce partenariat.Le partenariat se focalise sur le renforcement de la résilience malgache. Ainsi, les domaines du développement humain, l’agriculture résiliente, l’énergie, l’inclusion financière seront favorisés parmi tant d’au­tres secteurs. « L’idée étant que la population puisse avoir un bon départ et des racines solides depuis leur plus jeune âge afin qu’il soit plus productif et puisse avoir les capacités de se relever après chaque situation de crise », conclut la représentante.

Harilalaina Rakotobe

Midi Madagasikara3 partages

Projet BVPI-PHRD Itasy: Mise en relation directe entre les producteurs et les opérateurs

L’association « Tody » soutenue par le projet affichant un meilleur rendement de productivité, a été récompensée.

Le Centre de Service Agricole (CSA) FAMIMA a initié l’identification de l’offre et de la demande d’intrants et de matériels agricoles dans la région de l’Itasy.

 

C’est une grande première ! Le projet BVPI-PHRD (Bassins Versants-Périmètres Irrigués- Policy and Human Resources Development) sur financement de la Coopération japonaise et par le biais de la Banque mondiale, a soutenu cette initiative en organisant un atelier de mise en relation directe entre les producteurs et les opérateurs fournisseurs de ces intrants et matériels agricoles. « L’objectif consiste à développer l’agriculture commerciale, une des sous-composantes du projet, tout en facilitant l’accès à ces offres des opérateurs correspondant réellement aux besoins des exploitants agricoles », a expliqué Randrianirina Edmond, l’Assistant Technique des Opérations du projet BVPI-PHRD Itasy, lors de l’ouverture de cet atelier hier au « Tranompokonolona » de la Commune urbaine de Miarinarivo. 

Professionnalisation. Notons que ce projet est sous tutelle du Ministère auprès de la Présidence en charge de l’Agriculture et de l’Elevage. « A l’issue de cette rencontre, tous les paysans dans la région d’Itasy, bénéficiaires ou non de l’appui du projet, en tireront profit afin d’améliorer leur productivité tout en assurant leur professionnalisation », a fait savoir Andriamiarinera Serge, le directeur régional du Ministère chargé de l’Agriculture et de l’Elevage (DRAE). A titre d’illustration,  l’association PATMAD a présenté ses offres en matière de production d’énergies renouvelables et de l’agro-transformation, tandis que la société Agrivet a proposé une large gamme de produits d’intrants et de matériels agricoles ainsi que divers produits vétérinaires , des poussins et des additifs alimentaires, qui sont à la portée des paysans, selon ses dires. En outre, la société Agrival travaille en partenariat  avec la DRAE pour développer la filière maïs, et ce, en tant que preneur de la production des paysans.

Redorer l’image. Quant à la société STOI Agri qui est le premier producteur d’engrais organique, elle veut redorer l’image du lingot blanc dit de variété « Ranjonomby » à Madagascar en s’engageant  à acheter les récoltes des paysans pour satisfaire les commandes sur le marché international. En ce qui concerne  la société Guanomad, elle fournit des engrais biologiques comme le « guano ferti » et des insecticides bio ainsi que des engrais NPK granulés tout en assurant une livraison aux utilisateurs directs. Il y a également un autre type d’engrais en forme de bonbon proposé par un SGU avec un applicateur facile à fabriquer, pour sa mise en terre. Des paysans assistant à l’atelier témoignent de l’efficacité de cet engrais. Des points de vente à proximité des paysans sont en vue si ce n’est disponible que dans les grandes surfaces et en Europe. En outre, la société LDCM, le premier importateur d’engrais et de pesticides, offre diverses gammes de produits destinés à la campagne culturale jusqu’à la conservation des récoltes.  

Crédit sans garantie. D’autres opérateurs locaux proposent également des semences certifiées d’une quantité disponible de 90 tonnes. L’un d’entre eux dispose de jeunes plants de bambou servant à créer des sources de revenus supplémentaires pour les paysans tout en protégeant les bassins versants.  Il y a également des coopératives et un cluster spécialisés dans la fabrication des petits matériels agricoles tels que les charrues, les rayonneurs, les herses, les semoirs, les sarcleuses, les batteuses, les vanneuses et les hache-pailles. Mais ce n’est pas tout ! L’AccèsBanque offre un crédit spécifique dit « Tambatra » pour la région d’Itasy afin de faciliter l’acquisition de ces intrants et matériels agricoles. Il s’agit d’un crédit sans garantie pour un groupe de cinq à dix ménages au niveau du « fokontany ». Chaque ménage peut contracter un emprunt de 500 000 Ar à trois millions Ar payable de trois à douze mois, mais avec une caution solidaire de tous les membres du groupe.

Autonomie. Au final, les producteurs se disent être satisfaits de ces offres proposées lors de cette mise en relation directe avec les opérateurs. D’autres maires souhaitent l’organisation d’un tel événement dans leurs communes. « C’est un des moyens permettant de pérenniser les actions entreprises dans le cadre du projet qui va prendre fin en février 2018. Il faut que les paysans bénéficiaires puissent avoir leur autonomie à l’amélioration de leurs activités », a soulevé Hubert Rakotoarison, l’Assistant Technique des Opérations au niveau du projet national BVPI-PHRD.  Par ailleurs, des matériels agricoles et des pulvérisateurs ainsi que des coupes ont été remis aux organisations paysannes appuyées par le projet et affichant un meilleur rendement de productivité. Il s’agit de l’association « Tody » dans la commune de Sarobaratra. Sa présidente, Rasoamananjara a obtenu un rendement de 13,420 tonnes/ha. « Nous avons utilisé une nouvelle semence de variété « Mavolamba », avec des engrais Guanomad, du NPK et des urées. Des semis de jeunes plants de 15j ont été effectués. Et nous sommes tous intéressés par ces offres des opérateurs », a-t-elle conclu.   

Navalona R.

Madaplus.info2 partages

Mamy Rakotoarivelo s’est suicidé chez lui

Après celui de Chester Bennington du groupe Linkin Park, c’est le suicide, à l'aide d’une balle dans la tête, de Mamy Rakotoarivelo, membre du Parti TIM, qui fait le buzz sur les réseaux sociaux et médias sociaux malgaches depuis l’après-midi et qui sera surement la Une des JT ce soir et de tous les quotidiens demain.
Si on se réfère à ses dernières publications sur facebook. On pourrait penser qu’il s’agit d’un problème d’argent. Il a laissé une publication qui pourrait être sa façon à lui de dire adieu. « Quand je mourrai, ne venez pas sur ma tombe pour me dire à quel point vous m’aimiez et comme je vous manque, car ce sont des mots que je veux entendre pendant que je suis encore en vie. »
En outre il s’est confié sur sa page facebook dont en voice les détails M « Je voudrais me confier à mes amis sur fb de mes soucis graves actuels comme dit l'adage malgache : "Alahelo tsy ambara havana hono mbola zakan"ny tompony ihany". Et comme je ne le supporte plus, je me confie à vous sur les deux points suivants :
1) Comme la plupart d'entre vous le savent, j'ai divorcé de ma femme Juliana Faralalao ANDRIAMBELO en 2004. La grosse du jugement du tribunal stipule bien le partage moitié / moitié des biens communs. Ce partage n'a été fait qu'en 2016 pour diverses raisons. Après une entrevue avec M.le Procureur Général, il a été décidé que ce partage serait fait à l'amiable. Tout s'est fait tranquillement jusqu'au partage des bons de caisse anonymes. Je tiens à signaler que j'étais le DG de Midi Madagasikara S.A. de 1994 à 2002 et j en ai fait rentrer de l'argent dans la société d'autant que j'ai créé Midi Turf qui s'est vendu par centaines de milliers d'exemplaires par jour de 1997 à 1999 et j'ai créé aussi Gazetiko qui est devenu le premier quotidien de Madagascar. Avant d'intégrer Midi Madagasikara, j'ai convenu avec ma belle-mère, Mme Marthe Rajaofera ANDRIAMBELO, actionnaire majoritaire de la société, que les bénéfices seraient répartis moitié /moitié. Et comme je l'ai souligné plus haut, l'argent coulait à flots, bien que ma belle-mère était réticente à la création de Midi Turf et de Gazetiko. D'ailleurs, j'aurais pu faire imprimer ces deux journaux ailleurs. Toutes nos parts de bénéfices, je les ai confiées à ma femme qui les a placées en bons de caisse anonymes. Lors du partage des biens, il était légitime que je prenne une partie des bons de caisse anonymes. Après une grosse bagarre, mon ex femme a accepté de me donner un milliard de fmg qu'elle allait me donner en fonction de ses possibilités immenses par ailleurs. C'est là que les problèmes sont apparus parce que depuis l'accord intervenu fin décembre 2016, elle ne m'a donné en tout et pour tout que moins de 50 millions de fmg. Je lui ai demandé à plusieurs reprises de me donner 200 millions de fmg pour m'acheter une voiture mais à chaque fois, elle me disait qu'elle n'avait pas d'argent. Comme là, elle part au Canada en vacances, elle ne pouvait plus dire qu'elle n'avait pas d'argent. Et pourtant, lorsque j'ai demandé 25 millions de fmg, j'ai dû faire des pieds et des mains avant de les obtenir. J'ai même dû accepter de renoncer au reliquat de 950 millions de fmg mais c'est du blabla que j'ai accepté de signer comme ça et là, je persiste et signe qu'elle me doit encore 950 millions de fmg. Au cas où il m'arrive quoi que soit, elle devra s'en acquitter auprès de ma soeur, Misaharivoloniaina Razakahajaina RASOLOFO.
2) J'ai confié une grande partie de la vente des montres de luxe résultant du partage des biens à ma copine de l'époque, ANDRIANIVOSON Tiavina Corinne (plus connu sur fb sous le pseudo de Corinne Asmiël). Début mai, je lui ai demandé de me rendre les cent millions de fmg restants. Sa mère, Nirina RAJOELSON, m'a proposé de les faire tourner avec des vendeurs de pierre et d'en tirer le double après. Ne voyant pas l'argent venir au bout d'un mois et demi, j'ai râlé et elles m'ont demandé de patienter jusqu'au jour où elles m'ont appelé pour me dire soit disant qu'elles se sont prendre les cent millions de fmg par un pickpocket. Et elles ont attendu plus de deux mois pour me le dire. Je crois plutôt qu'elles ont plutôt utilisé l'argent pour autre chose. Elles aussi me doivent cette somme et dans le cas où il m'arriverait quelque chose , elles devront s'en acquitter auprès de ma soeur susnommée.
Voilà les problèmes qu'il fallait que j"évacue auprès de vous, chers amis de Facebook et je vous remercie de votre attention et de votre compréhension. Je sais que quelques uns d'entre vous me prendront pour un fou mais j'ai toujours été trop honnête au point d'être naïf. »
Madaplus.info2 partages

Mamy Rakotoarivelo se serait suicidé chez lui

Après celui de Chester Bennington du groupe Linkin Park, ce serait le suicide, à l'aide d’une balle dans la tête, de Mamy Rakotoarivelo, membre du Parti TIM, qui fait le buzz sur les réseaux sociaux et médias sociaux malgaches depuis l’après-midi et qui sera surement la Une des JT ce soir et de tous les quotidiens demain.
Si on se réfère à ses dernières publications sur facebook. On pourrait penser qu’il s’agit d’un problème d’argent. Il a laissé une publication qui pourrait être sa façon à lui de dire adieu. « Quand je mourrai, ne venez pas sur ma tombe pour me dire à quel point vous m’aimiez et comme je vous manque, car ce sont des mots que je veux entendre pendant que je suis encore en vie. »
En outre il s’est confié sur sa page facebook dont en voit les détails « Je voudrais me confier à mes amis sur fb de mes soucis graves actuels comme dit l'adage malgache : "Alahelo tsy ambara havana hono mbola zakan"ny tompony ihany". Et comme je ne le supporte plus, je me confie à vous sur les deux points suivants :
1) Comme la plupart d'entre vous le savent, j'ai divorcé de ma femme Juliana Faralalao ANDRIAMBELO en 2004. La grosse du jugement du tribunal stipule bien le partage moitié / moitié des biens communs. Ce partage n'a été fait qu'en 2016 pour diverses raisons. Après une entrevue avec M.le Procureur Général, il a été décidé que ce partage serait fait à l'amiable. Tout s'est fait tranquillement jusqu'au partage des bons de caisse anonymes. Je tiens à signaler que j'étais le DG de Midi Madagasikara S.A. de 1994 à 2002 et j en ai fait rentrer de l'argent dans la société d'autant que j'ai créé Midi Turf qui s'est vendu par centaines de milliers d'exemplaires par jour de 1997 à 1999 et j'ai créé aussi Gazetiko qui est devenu le premier quotidien de Madagascar. Avant d'intégrer Midi Madagasikara, j'ai convenu avec ma belle-mère, Mme Marthe Rajaofera ANDRIAMBELO, actionnaire majoritaire de la société, que les bénéfices seraient répartis moitié /moitié. Et comme je l'ai souligné plus haut, l'argent coulait à flots, bien que ma belle-mère était réticente à la création de Midi Turf et de Gazetiko. D'ailleurs, j'aurais pu faire imprimer ces deux journaux ailleurs. Toutes nos parts de bénéfices, je les ai confiées à ma femme qui les a placées en bons de caisse anonymes. Lors du partage des biens, il était légitime que je prenne une partie des bons de caisse anonymes. Après une grosse bagarre, mon ex femme a accepté de me donner un milliard de fmg qu'elle allait me donner en fonction de ses possibilités immenses par ailleurs. C'est là que les problèmes sont apparus parce que depuis l'accord intervenu fin décembre 2016, elle ne m'a donné en tout et pour tout que moins de 50 millions de fmg.
Je lui ai demandé à plusieurs reprises de me donner 200 millions de fmg pour m'acheter une voiture mais à chaque fois, elle me disait qu'elle n'avait pas d'argent. Comme là, elle part au Canada en vacances, elle ne pouvait plus dire qu'elle n'avait pas d'argent. Et pourtant, lorsque j'ai demandé 25 millions de fmg, j'ai dû faire des pieds et des mains avant de les obtenir. J'ai même dû accepter de renoncer au reliquat de 950 millions de fmg mais c'est du blabla que j'ai accepté de signer comme ça et là, je persiste et signe qu'elle me doit encore 950 millions de fmg. Au cas où il m'arrive quoi que soit, elle devra s'en acquitter auprès de ma soeur, Misaharivoloniaina Razakahajaina RASOLOFO.
2) J'ai confié une grande partie de la vente des montres de luxe résultant du partage des biens à ma copine de l'époque, ANDRIANIVOSON Tiavina Corinne (plus connu sur fb sous le pseudo de Corinne Asmiël). Début mai, je lui ai demandé de me rendre les cent millions de fmg restants. Sa mère, Nirina RAJOELSON, m'a proposé de les faire tourner avec des vendeurs de pierre et d'en tirer le double après. Ne voyant pas l'argent venir au bout d'un mois et demi, j'ai râlé et elles m'ont demandé de patienter jusqu'au jour où elles m'ont appelé pour me dire soit disant qu'elles se sont fait prendre les cent millions de fmg par un pickpocket. Et elles ont attendu plus de deux mois pour me le dire. Je crois plutôt qu'elles ont plutôt utilisé l'argent pour autre chose. Elles aussi me doivent cette somme et dans le cas où il m'arriverait quelque chose , elles devront s'en acquitter auprès de ma soeur susnommée.
Voilà les problèmes qu'il fallait que j"évacue auprès de vous, chers amis de Facebook et je vous remercie de votre attention et de votre compréhension. Je sais que quelques uns d'entre vous me prendront pour un fou mais j'ai toujours été trop honnête au point d'être naïf. »
News Mada2 partages

Le directeur de l’intérieur libéré: le SMM stupéfait

Nouveau rebondissement dans l’affaire Claudine Razaimamonjy. En fait, le directeur du concours financier au sein du ministère de l’Intérieur,  impliqué dans le dossier de détournement de deniers publics a bénéficié d’une liberté provisoire mardi, après avoir fait l’objet d’un mandat de dépôt prononcé par les juges de la Chaîne pénale anti-corruption (CPAC) lundi. Le SMM n’en revient pas.

«Cette décision nous a laissés stupéfaits», a indiqué la présidente du Syndicat des magistrats de Madagascar (SMM), Fanirisoa Ernaivo, joint au téléphone hier. Elle s’étonne en effet qu’une personne ayant déjà fait l’objet d’un mandat de dépôt puisse du jour au lendemain bénéficier d’une liberté provisoire.

«Il est nécessaire que les juges ayant statué sur cette affaire donnent de sérieuses explications à la population, car nous-mêmes, nous sommes très surpris», a-t-elle expliqué.

A titre de rappel

Lundi dernier, le directeur des concours financiers de l’Etat auprès du ministère de l’Intérieur et de la décentralisation a été déféré auprès de la CPAC après enquête auprès du Bureau indépendant anti-corruption. Placé sous mandat de dépôt pour abus de fonction, détournement de deniers publics et complicité concernant les subventions exceptionnelles dans la commune d’Analalava, ce dernier a été libéré le lendemain après avoir fait opposition de la décision des juges.

Sur les quatre personnes déférées à la CPAC en début de semaine, trois ont obtenu leur liberté  tandis que le maire d’Ialanindro reste en prison pour la suite de l’enquête.

Aucune voie de recours

«Malheureusement, le SMM ne peut rien faire face à cette situation puisqu’aucune voie de recours n’est prévue par la loi», a fait savoir la présidente du SMM. De son côté, le Bianco semble également impuissant bien qu’il ait participé à l’enquête menant à l’arrestation dudit directeur.

Par ailleurs, la lutte pour l’indépendance de la justice se poursuit. «Nous poursuivons les opérations de sensibilisation auprès des magistrats dans l’objectif d’assainir le monde de la Justice et lutter contre la corruption», a soutenu Fanirisoa Ernaivo. Cela, en parallèle avec le dialogue de la Commission tripartite avec la Primature et le ministère de la Justice.

Notons que leur  revendication sur l’indépendance de la justice a débuté au début de cette année. L’affaire de corruption impliquant la conseillère spéciale du président, Claudine Razaimamonjy, a été le premier défi. Cependant, le SMM a rassuré que cette affaire ne sera pas la dernière vu la détermination des magistrats à aller au bout de leur objectif.

Tahina Navalona

News Mada2 partages

Face à l’entêtement de l’Etat: le Tim prend acte

La formation politique «Tiako i Madagasikara» (Tim) abandonne la partie. Sans surprise, le préfet  de police d’Antananarivo a en effet décidé d’interdire la célébration du XVe anniversaire du groupe à Mahamasina dans une lettre adressée au bureau de cette formation politique hier.

Tout de suite après, dans un communiqué, le parti de l’ancien Président Marc Ravalomanana a réagi en indiquant son attachement à la loi. «Nous estimons que la décision du préfet ressort d’un excès de pouvoir manifeste, mais dans un esprit d’apaisement et dans un souci de profond respect de la loi, nous nous y conformons», souligne le communiqué signé par le secrétaire général de cette formation. La missive ajoute que le parti Tim a bel et bien reçu la décision en date du 27/07/2017 du préfet de police d’Antananarivo refusant l’autorisation du parti à célébrer son 15e anniversaire au stade de Mahamasina et «en prend acte».

Résignation

Le parti ajoute cependant que la dernière tentative de célébration de son XVe anniversaire n’a provoqué ni de bavures, ni de victimes et encore moins de pillages. «Il n’y a pas eu de manifestation sur la voie publique, les gens empêchés de pénétrer dans le stade malgré le jugement n° 59 du 07/07/2017 du Tribunal Administratif les y autorisant ont tenu à ramener le Président Ravalomanana Marc en sa demeure à Faravohitra», note le communiqué. Toujours à ce titre, le Tim assure qu’il n’y a eu aucun incident sur leur passage : personne n’a été blessé et pas de magasin ni de voiture vandalisés et ce, malgré les tirs de gaz lacrymogène utilisés à mauvais escient par les forces de l’ordre.

Le 8 juillet dernier, le Tim avait prévu de manifester dans l’enceinte du stade municipal de Mahamasina avec l’aval de la Préfecture de la capitale dans un premier temps. Le représentant de l’Etat s’est par la suite ravisé, créant une vive tension entre les partisans de cette formation politique et le régime. Pour légitimer sa décision d’annuler la manifestation, les autorités ont mis en avant les risques de troubles. Après un bref rassemblement au Carlton, les membres du parti ont choisi de se disperser tandis que d’autres groupes ont choisi de descendre à Analakely mais les forces de l’ordre les ont empêchés de se regrouper sur la place du 13 mai. C’est ainsi que le camp Ravalomanana a essayé une nouvelle fois de revenir à Mahamasina, sauf que la Préfecture de la capitale a maintenu son interdiction. A cette allure, à moins d’un nouveau recours auprès du Taf, la formation politique de l’ancien Chef de l’Etat ne pourra pas réunir ses partisans à Mahamasina, ce samedi.

J.P

News Mada2 partages

Smile Party: un festival haut en couleurs

Smile party entame sa 13e édition pour une ambiance post-bac des plus festives, ce soir, au palais des Sports et de la culture à Mahamasina.

Initié par la Radio des jeunes (RDJ) et son équipe, Smile party réserve comme chaque année son lot de surprises. D’après les informations reçues, tout est déjà fin prêt pour offrir un majestueux spectacle de son et lumière.

Pour cette édition, les artistes représentatifs d’une nouvelle génération vont se relayer sur la scène, à savoir Arione Joy, Andriann, Jess Flavi One, Meizah, Rak Roots, Mr Sayda, Jyunii et Melanie Walker. Les augustes murs du palais des Sports seront illuminés tandis que  la musique entrainante de la RDJ’s Team va gâter une nouvelle fois les noctambules.

«La dernière édition à l’AFT Andavamamba a réuni plus de 3 000 personnes et cette année, nous n’en attendons pas moins», annonce Teejay Jerry.

Joachin Michaël

News Mada2 partages

Atsimo Andrefana: sensibilisations sur l’hygiène à Toliara

La commune urbaine de Toliara et le projet Passat de l’ONG Welthungerhilfe renforcent leur partenariat dans les activités liées à l’hygiène et la propreté. Un grand concours de sensibilisation a été organisé à cet effet pour améliorer l’approche en matière de sensibilisation.

Propulsé par la pièce intitulée «Soa ty malio», le groupe Miray a conquis le public et le jury pour remporter le premier prix du grand concours de théâtre «Toliara Mihisa» co-organisé par la commune urbaine de Toliara et le projet Passat de l’ONG Welthungerhilfe (WHH) au Vakok’ArtsTrano, mercredi.

L’objectif étant de  faire passer le message et faire évoluer les mentalités, les organisateurs ont expliqué  que la sensibilisation par le théâtre, vecteur de communication de proximité, est l’option la plus adaptée pour la réussite de l’initiative.

Sensibilisation

 Durant les trois années de collaboration de la commune urbaine de Toliara et du projet Passat, la troupe de théâtre Katrafay a fait la tournée hebdomadaire des quartiers avec les équipes d’animation du projet et de la Commune pour sensibiliser la population sur l’usage des bennes à ordures, la gestion des déchets ménagers, l’hygiène et la propreté en général. Des écrans vont dorénavant être déployés dans toute la ville pour diffuser en boucle des spots et des pièces de théâtre sur l’hygiène et la propreté en ville  pour renforcer les acquis.

Le projet Passat, destiné à l’assainissement solide et la sécurité alimentaire à Toliara, est financé par le ministère de la coopération allemande (BMZ) pour l’un des 5 projets de l’ONG Welthungerhilfe à Madagascar. Il intervient pour mettre en place un plan de gestion des déchets en milieu urbain depuis août 2014 et contribuer ainsi au développement de la ville de Toliara en partenariat avec la commune.

Manou

 

Midi Madagasikara2 partages

Processus électoral: La Ceni pointée du doigt par la société civile !

Une fois de plus, la Commission Electorale Nationale Indépendante ou Ceni reçoit des critiques de la part de la société civile.

Il s’agit de l’association dénommée « Fikambanan’ny Tanora Mandala ny Fahamarinana mba ho fampandrosoana ny firenena » ou FTMF qui a émis urbi et orbi, hier, les doutes qu’elle éprouve quant au « semblant » d’indépendance de la Ceni, mais également aux cas de figure qui mettent en cause la transparence tant conjuguée par le président de la commission électorale, Hery Rakotomanana. « Il est vrai que l’organisation d’élections libres, transparentes, inclusives et acceptées par tous soit l’unique moyen qui respecte le choix du peuple. On reconnaît également que la Ceni a entrepris beaucoup d’efforts par rapport aux structures précédentes telles que la Ceni-T. Pourtant, nous constatons des anomalies », indique-t-on dans un communiqué du FTMF signé par son président Ramiarondraibe Hajason.

Cachotier. Dans un rapport présenté le 11 juillet dernier, la Ceni a affirmé que les travaux de la commission consultative de réflexion et de proposition sur l’amélioration de l’encadrement juridique du processus électoral malgache sont achevés et que la balle est désormais dans le camp de l’Exécutif. Ensuite, un comité interministériel se chargera de la rédaction de l’avant-projet de texte relatif aux élections. Mais déjà, au niveau de la composition de ce comité interministériel, les critiques fusent vu le nombre excessif de représentants des autorités étatiques présents. Par ailleurs, selon le FMTF, en se basant sur le texte régissant la commission électorale, «les 22 régions devraient comporter chacune une commission électorale régionale ou CER. Mais jusqu’à maintenant, aucune nomination n’est effectuée alors que les membres de la commission électorale provinciale ou CEP au niveau de chaque province ont déjà pris leurs fonctions ». Cette association s’interroge alors si quelque part, l’on veut méconnaître cette disposition légale pour laisser place aux diverses cachoteries. Le FMTF fustige également le remplacement occulte des membres des démembrements de la Ceni au niveau des Districts. «C’est signe de puérilité et de manque de transparence. La nomination de certains membres ne suit pas les normes », soutient l’association. Pour couronner le tout, le FMTF regrette l’exclusion de la société civile dans la sensibilisation des citoyens à participer au processus électoral. «Cette sensibilisation relève de la société civile. Mais actuellement, on s’aperçoit que la Ceni s’y met tellement alors qu’elle ne devrait faire qu’agencer », continue-t-elle. Néanmoins, et nonobstant ces péripéties, l’association lance un appel au Parlement afin d’appliquer les recommandations émanant de la commission consultative.

Aina Bovel

La Vérité1 partages

Décès de Mamy Rakotoarivelo - Meurtre ou suicide ?

L'information a secoué le tout Antananarivo. L'ancien président du Congrès de la Transition Mamy Rakotoarivelo a été retrouvé mort à son domicile. L'hypothèse d'un suicide est évoquée. Les circonstances du décès sont toutefois encore floues pour l'heure.

La nouvelle a fait l'effet d'un véritable tremblement de terre. Le corps sans vie de Mamy Rakotoarivelo a été retrouvé à son domicile à Ankadifotsy, hier en fin de matinée. « La police scientifique et technique, la brigade criminelle et la police du troisième arrondissement sont ici présentes pour effectuer les premières constations. Il a été constaté que le ray aman-dreny Mamy Rakotoarivelo a effectivement été retrouvé mort dans sa chambre à coucher », d'après les premières informations délivrées par le commissaire principal Jean de Matha Rakotondrasoa, chef de service central des affaires criminelles de la Direction de la police judiciaire au sein de la Police nationale, venu sur place pour faire les premiers constats.  Les circonstances exactes de la mort de ce personnage politique sont pour l'heure encore floues. S'agit-il d'un meurtre ou d'un suicide ? « Le rapport d'autopsie nous en dira plus », précise le commissaire de police Jean de Matha, précisant que « des enquêtes sont déjà ouvertes ». Des informations rapportent que l'ancien directeur général de la « Malagasy Broadcasting System » (Mbs) se serait tiré une balle dans la tête. L'employée de maison qui était seule avec Mamy Rakotoarivelo au moment des faits a pourtant rapporté avoir entendu deux coups de feu, avant de pénétrer dans la chambre où elle a vu le corps sans vie de son employeur. De leur côté, les voisins de cet ex- proche de l'ancien président Marc Ravalomanana indiquent ne pas avoir entendu de détonations. Le décès de l'ex-ministre de la Communication aurait eu lieu aux alentours de 11 heures, selon les premières constatations du commissaire de police Jean de Matha. Un pistolet a également été retrouvé sur les lieux. « Nous ne pouvons cependant pas affirmer pour l'heure s'il s'agit de l'arme ayant servi et entraîné la mort de la victime », précise toutefois ce haut fonctionnaire de police. Vers 15 heures, le corps de cet ancien parlementaire a été récupéré par le Bureau municipal d'hygiène puis emmené à au Chu-Hjra d'Ampefiloha dans la foulée des premiers constats. Les raisons du meurtre ou du suicide ne sont pas encore déterminées avec exactitude.  Décrit comme dépressif par ses proches, Mamy Rakotoarivelo, ancien Secrétaire général du  « Tiako i Madagasikara », a toutefois laissé derrière lui un long message sur son compte « Facebook ». La veille de son décès subit, il a en effet publié une lettre qui  pourrait être interprétée comme une lettre d'adieu par certains observateurs. Notons que quelques heures seulement avant de passer de vie à trépas, Mamy Rakotoarivelo publie une citation sur son compte facebook. « Quand je mourrai, ne venez pas sur ma tombe pour me dire à quel point vous m'aimiez et comme je vous manque, car ce sont des mots que je veux entendre pendant que je suis encore en vie », peut-on lire. En tout cas, l'opinion attend désormais la publication du rapport d'autopsie et le résultat des enquêtes menées par la police. Natif de Vinanikarena, le corps du défunt devrait rejoindre dans les prochains jours le Vakinankaratra, sa terre natale, pour y être enterré.Recueillis par Lalaina A.

L'express de Madagascar1 partages

Matériaux de construction – Sika mise sur la qualité

Journée d’information et de démJournée d’information et de démonstration sur les produits Sika avant-hier à la Chambre de commerce et d’industrie France Mada­gascar. Sika, une entreprise française qui existe depuis 100 ans est spécialisée en étanchéité et réparation des bétons. « Les produits Sika sont réputés pour leur qualité, la longévité de leurs solutions répondant aux exigences les plus sévères », souligne Didier Husson,  responsable Sika dans la région océan Indien. Les constructions dans les pays tropicaux doivent suivre des normes  spéciales qui exigent l’utilisation de matériaux adaptés.À entendre la présentation, l’imperméabilisation et la protection des fondations, les murs, façades et toitures, traitement des remontées capillaires, étanchéité sous carrelage peuvent être assurés par  les produits Sika. Aussi, les professionnels de bâtiment, grandes sociétés de construction, bureaux d’études, architectes et distributeurs de matériaux de constructionet le ministère des Travaux publics ont-ils été éclairés sur les techniques et les produits liés au collage et à l’étanchéité.La compagnie Madécasse  est le distributeur de la marque Sika à Madagascar.

Mirana Ihariliva

L'express de Madagascar1 partages

Pétanque - Masters – Deux points  pour Madagascar

La sélection malgache a bouclé la troisième étape des Masters de pétanque avec un gain de deux points. Ce qui porte son total à douze unités dans cette tournée 2017. Hier à Clermont-Ferrand, elle a été sortie d’entrée par l’équipe de France, en quarts de finale.Christian « Nanou » Andrianiaina, Hery Razafi­mahatratra et Tojo « Cobra » Rahasintsoa se sont inclinés devant le trio composé de Philip­pe Quintais, Philippe Suchaud et Michel Loy(7-13). Suite à cette élimination d’entrée, la Grande île était donc reversée en barrages. L’occasion pour elle de s’imposer face à l’équipe locale et de limiter la casse donc, en empochant deux points. Malgré cela, Mada­gascar devrait perdre sa place au sein du top 4.

H.L.R.

Madaplus.info0 partages

Madagascar devrait être le grenier de l’océan Indien d’ici trois ans

Avec les partenariats signés cette semaine, Madagascar aura une autosuffisance en riz en 3 ans et devrait être le grenier de l’Océan Indien.
La semaine dernière Madagascar a signé un partenariat pour la mise en place d’une usine de fabrication d’engrais dont Madagascar a besoin pour sa production agricole. En outre, le Japon a octroyé la somme de 80 millions d’Ariary à investir dans la maitrise de l’eau. Le gouvernement a aussi signé un partenariat pour la maitrise des semences. Le ministre chargé de l’élevage a affirmé que tout cela va pouvoir nous aider à avoir une autosuffisance en riz et devenir le grenier de l’océan Indien en 2020. Enfin, des opérateurs économiques indiens vont installer une usine pour la fabrication de tracteur à Madagascar. Ce sera une opportunité d’une forte mécanisation agricole dans le pays et va créer des emplois pour les jeunes.
Madaplus.info0 partages

Le maire de Toamasina a été mis en examen hier

Élysée Ratsiraka a été mis en examen au sein de son bureau à l’Hôtel de Ville de Toamasina hier pendant 4 heures de temps.
Cette mise en examen du maire fait suite à une plainte déposée par le président du conseil municipal de Toamasina à son encontre. Les points mis en exergue dans cette plainte sont : la vente illégale de terrain de la commune, décaissement des salaires des employés de la commune qui ne sont pas parvenus aux employés. Avant le maire Élysée Ratsiraka, cinq employés de la commune proche de du maire ont aussi fait l’objet de cette mise en examen par la police. Le maire n’a pas voulu parler à la presse à sa sortie de son bureau.
Madaplus.info0 partages

Hôte de l’ADN (Arche de la Nation) – Un cador de l’International Liberal dans nos murs

Secrétaire général de l’International Liberal, Emil Kirjas est, à Madagascar, depuis hier. Sa visite consiste en un échange avec le parti ADN pour voir comment la fédération mondiale peut aider à l’amélioration de la situation dans le pays.
Une grande opportunité. Selon Emil Kirjas, secrétaire général de l’Inter­national Liberal, être membre du réseau international des partis libéraux, ouvre d’énormes opportunités. En réponse à l’invitation du parti Antoka sy dinan’ny Nosy– Arche de la Nation (ADN), c’est justement, pour capitaliser ces opportunités que ce cador de la fédération mondiale des entités politiques libérales est, à Mada­gascar. Une première dans l’histoire de la pratique politique, dans la Grande île.
À son arrivée de Londres, à l’aéroport d’Ivato, hier, l’homme politique a déclaré: « Je suis heureux d’être parmi mes amis, mes collègues. J’ai beaucoup appris de Madagascar, par le biais de mes amis de l’ADN. (…) je suis fier d’être ici parmi mes collègues pour parler, débattre, échanger avec eux de ce que l’on peut faire sur la scène nationale et internationale, sur le plan politique, pour améliorer la vie de tout le monde dans ce pays ».
Fort d’un important réseau de partis politiques dans le monde, et de 70 ans d’existence, l’International Liberal, « donne une opportunité de faire des échanges d’idées, de projet », a indiqué celui qui a été l’un des plus jeunes ministres de la Macédoine. L’atout de « cette grande famille dont est membre depuis mai, le parti ADN », comme il l’a souligné, est, aussi, que plusieurs de ses membres sont, soit au pouvoir, soit des élus dans les Parle­ments de leur pays.
En Afrique, la Côte d’Ivoire, le Sénégal, ou encore, le Maroc, sont, par exemple, des pays dirigés par des libéraux. Comme l’affirme l’ancien ministre des Affaires étrangères macédonien, ceci permet « de voir comment des projets ayant réussi ailleurs peuvent être modifiés et adaptés à Madagascar, par exemple ». Il a joute que « cela ouvre, également, de grandes opportunités de faire la promotion du pays, des opportunités qui existent ici ».
Sources Express de Madagascar
News Mada0 partages

Fanodinkodinam-bola, fivarotana tany, karama: nohadihadin’ny polisy ny ben’ny Tanàna Ratsiraka Elysé

Ho lasa lavitra ny raharaha ? Nohadihadin’ny polisy tao amin’ny birao fiasany ao amin’ny lapan’ny Tanànan’i Toamasina ny ben’ny Tanàna, Ratsiraka Elysé, omaly. Anisan’ny namotorana azy ny resabola sy ny momba ny tanim-panjakana ary koa ny karaman’ny mpiasa.Anisan’ny iahiahiana ity mpitantana ao Toamasina ity ny momba ny fanodikodinam-bola voatokana ho an’ny solika, mitentina 375 tapitrisa Ar. Eo koa ny fivarotanatanim-panjakana etsy amin’ny cité Duplex. Nivarotra izany taminy ny ben’ny Tanàna lefitra voalohany Dihn Vanh Ricky sady nomena fahazoan-dalana hivarotra ny tanin’ny kaominina, tsy mifanaraka amin’ny vidin’ny tanim-panjakana. Manampy ireo ny momba ny karaman’ny mpiasa, mivoaka avy ao amin’ny tahirim-bolam-panjakana nefa tsy voarain’ny mpiasa misoratra amin’ny antontan-taratasim-bola akory. Naharitra ora efatra ny faharetan’ny famotorana nataon’ny polisy misahana ny heloka ara-bola an-dRatsiraka Elysé. Efatra  ireo nanao ny fanadihadiana azy ka nahitana ofisie iray, inspekitera roa ary brigadie  iray. Teo koa ny mpisolovava ny ben’ny Tanàna.

Mametraka ahiahy ny maro…

Nanamarika izao fanadihadiana izao ny lalan-kafa nivoahan’ireo polisy efa-dahy sy ny mpisolovava an-dRatsiraka Elysé. Nivoaka amin’ny varavarana hafa, fandehanan’ny ben’ny Tanàna rehefa amin’ny vanim-potoana sarotra na misy korontana fa tsy tamin’ny nidirany teo am-pahatongavana izy ireo. Teo koa ny nahitana mpiasa iray, misahana ny arofenitry ny ben’ny Tanàna, nivezivezy mandeha fiara nefa avy eo miverina indray, nandritra ny famotorana. Ametrahan’ny maro ahiahy tanteraka avokoa izany rehetra izany.

Etsy andaniny, nilaza ireo mpahay lalana sy manamboninhaitra anivon’ny polisy sasantsasany fa azo heverina ny hiakaran’ ity raharaha ity eny anivon’ny fampanoavanaambaratonga voalohany, ny asabotsy izao.

Ben’ny Tanàna Mapar

Araka izany, andrasana ny ho tohiny ka mba tena handeha hatramin’ny farany, ahitana na mitombina na tsia izany rehetra izany. Olon’ny Mapar rahateo ity ben’ny Tanàna ity. Efa nanambara ny mpitondra, indrindra ny filoha Rajaonarimampianina tamin’ity herinandro ity fa ho hentitra ny tenany momba ny volam-panjakana. Amin’ny ankapobeny, tsy ananana havana izany araka ny nambarany ary efa anisan’izany ireny « Raharaha Razaimamonjy Claudine » ireny. Mba tsy ho pimaso na resabe fotsiny na hakana fon’ny olona izany fa tanterahina ary tohizana hatramin’ny farany…

Sajo sy Synèse R.

News Mada0 partages

MFB: accueil officiel de la nouvelle ministre

Vonintsalama Andriambololona, la nouvelle ministre des Finances et du budget fraîchement nommée, a été reçue officiellement, hier, à Antaninarenina par la famille du ministère.

Dans son allocution, la ministre a tenu à encourager ses collaborateurs dans la poursuite des efforts déjà entrepris et ce, dans le respect des textes en vigueur. Par ailleurs, elle a insisté sur la nécessité et l’importance de la mise en œuvre des dispositions du Plan national de développement (PND) tout en mettant l’accent sur la lutte anticorruption. Le Grand argentier s’est engagé, pour son compte, a poursuivre les diverses réformes engagées au niveau de son département ministériel.

Figure non méconnue au sein de ce département, Vonintsalama Andriambololona a passé sa carrière au sein des ministères en charge des Finances et du budget, de l’Economie, du Plan en ayant été directeur général du Trésor de 1996 à 2003 et secrétaire générale du ministère des Finances et du budget de 2009 à 2015.

Arh.

 

News Mada0 partages

Les clichés de la semaine

Moyens de transport dans la région Androy.

En attendant la décision de la Préfecture de police, les partisans de Marc Ravalomanana ont poursuivi leur répétition.

Ultime hommage à l’accordéoniste Régis Gizavo.

Olombelo Ricky et le traditionnel « Manal’azy vita bac ».

Une partie des armes saisies par la police en moins de deux mois dans la capitale.

La région Analamanga a remis sept motos à la gendarmerie.

L’Iscam s’est distingué en obtenant son certificat « EFMD deans across frontiers » durant l’Award ceremony.

Le nouveau Cadre de partenariat pays (CPP) de la Banque mondiale avec la République de Madagascar a été présenté officiellement hier.

News Mada0 partages

Foot – CAN 2019: polémique quand tu nous tiens !

Des médias camerounais parlent de «règlement de comptes» entre le président sortant de la Confédération africaine de football (Caf), Issa Hayatou, et l’actuel homme fort du football continental, Ahmad. En effet, ils ont avancé que l’institution africaine veut barrer le chemin au Cameroun en vue de la Can 2019 avec cette nouvelle formule à 24 pays. Une polémique qui ne date pas d’aujourd’hui, plus précisément, cela dure depuis le début de la campagne présidentielle des deux camps.

Sans vouloir remuer le couteau dans la plaie, il y a encore du chemin à faire malgré les résolutions prises sur le développement du football africain dirigé par le comité exécutif de la Caf, quelques semaines passées. Pire, bien des médias camerounais (ndlr, des informations relatées plus tard sur d’autres sites d’informations africains) ne voient pas cette décision de bon œil en déclarant qu’il y a aunguille sous roche et qu’il s’agit tout simplement d’un règlement de comptes après le retrait de l’organisation de la Can U17 2017 des mains de Madagascar par l’ancien patron de la Caf, Issa Hayatou.

«La Can sera disputé avec 24 pays au lieu de 16 entre les mois de juin et de juillet, au lieu de janvier et février. Une décision effective dès la prochaine édition de la compétition. Au-delà d’une révolution, elle semble camoufler les intentions que certains avisés prêtaient au Malgache Ahmad de vouloir tout faire pour retirer au Cameroun l’organisation du plus prestigieux événement sportif du continent, en guise de vengeance contre son prédécesseur, le Camerounais Issa Hayatou qui a retiré la Can U17 2017 à Madagascar au profit du Gabon» , ont precisé les medias camerounais.

Et ces derniers de poursuivre que «Si on s’en tient à la dernière édition de la Can, on peut déduire que le Cameroun aura besoin d’au moins 500 milliards Fcfa pour respecter le cahier des charges de la Caf. Alors que l’enveloppe de la 31e édition de la Can gabonaise s’est chiffrée à 463 milliards bien que seuls 16 pays étaient en lice», a-t-on lu sur un site d’informations camerounais. Des déclarations qui illustrent leur inquiétude sur un potentiel retrait de l’organisation de la prochaine grande messe continentale pour bon nombre de raisons. Polémique quand tu nous tiens !

Rojo N.

News Mada0 partages

Badminton: la crème de la crème s’affronte

Du côté du badminton, les grandes vacances ne sont pas encore pour tout de suite! Ce samedi au gymnase d’Ankorondrano, une compétition inédite s’annonce sulfureuse car  les meilleurs badistes du moment dans leur catégorie respective sont en tête d’affiche.

Deux défis sont au menu, à savoir les Masters mettant aux prises les 8 meilleurs badistes hommes de la série reine et le Top futur, réservé aux 18 joueurs les plus performants du moment dans les catégories U9 et U12 et avec une seule fille prénommée, Aina, dans la mêlée.

Naisa

La liste des participants

Masters:

Poule A: Aina Marc, Ludovic, Tahiry, Eugelinho,

Poule B: Keman, Julio, Tolotra, Tokinirina.

Top Futur:

Poule A: Sitraka, Aina, Frederic, Lanja, Mamitiana.

Poule B: Heritiana, Henintsoa, Jean-Claude, Eddinoh, Loan.

Poule C: Lova Marc, Eugenio, Mparany, Robena,

Poule D: Zo, Hervé, Thierry, Logan

News Mada0 partages

Gisement de saphirs d’Ambanja: 55 personnes dont quatre femmes écrouées

Cinquante-cinq personnes dont quatre femmes ont été présentées hier devant le Parquet d’Ambanja à la suite d’un incendie volontaire dont ont été victimes des habitants d’Andampy, commune d’Antranonkarany.

La tension a atteint son summum à Andampy la semaine passée. Les habitants de cette localité se trouvant à 18 km au sud d’Ambanja ont farouchement refusé de céder leur terrain à des exploitants illicites. De leur côté, ces derniers sont allés jusqu’à proférer des menaces qu’ils ont mises à exécution dimanche. Arrêtés, 55 d’entre eux ont été déférés hier à Ambanja. A l’issue de leur audition, ils ont été placés sous mandat de dépôt.

«Ces gens ont déjà exploité illégalement une carrière de saphirs dans les parages. Ils sont partis il y a deux ou trois ans de cela mais maintenant, ils sont revenus sous prétexte qu’ils ont trouvé un nouveau filon. Evidemment, nous avons refusé de leur céder notre terre», a expliqué une source locale.

Ce refus a provoqué la colère des intrus. Une violente altercation a eu lieu et afin de désamorcer la situation, des responsables de l’Organe mixte de conception se sont rendus sur les lieux. Un terrain d’entente aurait été trouvé mais après le départ des autorités, les exploitants illicites sont revenus à la charge et ont incendié une maison.

  Face à cette tournure aussi brusque qu’inattendue, l’OMC a dépêché lundi des policiers et des gendarmes sur place afin de sécuriser le site et par la même occasion procéder à des arrestations. Cinquante-cinq exploitants illicites dont quatre femmes ont été arrêtés. Toujours d’après la source, les autres squatters ont incendié une autre maison avant-hier.

Mparany

 

News Mada0 partages

Sécurisation: sept motos pour la gendarmerie

Dans le cadre du Projet 2016 et en vue de renforcer la capacité de mobilité des services dans la Circonscription de gendarmerie nationale d’Antananarivo (CIRGN Tana), la région Analamanga a fait un don de  sept motocyclettes dans la matinée d’hier.

La cérémonie de remise des clefs s’est tenue sur le terrain de rapport de la caserne d’Ankadilalana en présence de plusieurs hautes personnalités dont Ndranto Rakotonanahary, chef de la  région Analamanga, le général Njatoarisoa Andrianjanaka, commandant de la CIRGN Tana et le colonel Zafisambatra Ravoavy, commandant du Groupement de gendarmerie d’Analamanga.

Lors de son allocution, le chef de la région Analamanga a indiqué que ces motos permettront aux gendarmes d’avoir une plus grande mobilité dans la lutte contre l’insécurité et la sécurisation routière. Il a également promis que la région entend doubler, voire tripler, le nombre de moto à offrir dans le cadre du Projet 2017, et la police nationale figurera dans la liste des bénéficiaires.

Tout en remerciant la région, le général Njatoarisoa Andrianjanaka a rassuré qu’il veillera personnellement sur l’utilisation de ces deux-roues.

Mparany

News Mada0 partages

Nosy Bé: Des enfants maltraités placés en familles d’accueil

Un nouveau système de réponse vient d’être lancé à Nosy Be pour faire face à la maltraitance des enfants au niveau du cercle familial. Six enfants ont bénéficié d’un accompagnement allant dans ce sens depuis octobre 2016.

Les auteurs de violence sont les membres de la famille. Ce fait  a pris ces dernières années une certaine ampleur dans la ville touristique de Nosy Be où la monoparentalité qui se banalise, favorisant entre autres par l’union libre, ne fait qu’aggraver la situation.

Les vécus de quelques enfants placés depuis 2016 sous la responsabilité et la protection de familles d’accueil, un nouveau dispositif mis en place par le ministère de la Population, de la protection sociale et de la promotion de la femme (MPPSPF) et ses partenaires, dont l’Unicef, en témoignent. Parmi lesquels figure Martine, un nom d’emprunt, une fillette de 16 ans, originaire d’Antalaha, abandonnée toute seule, en état de grossesse, à Nosy Be par l’homme qui a promis de l’épouser.

Loin de sa famille, notamment de sa mère qui vit à Antalaha et son père à Toamasina, cette dernière a été accueillie depuis le mois d’avril dernier par l’une des dix familles d’accueil qui existent actuellement sur place.

Sa mère de substitut, un agent communautaire fortement engagé dans le social, lui apporte toute l’affection, la protection qu’elle a besoin en attendant sa réinsertion au  niveau de sa famille, qui devrait se faire après l’accouchement. «Moi, comme mes enfants, le considère comme une membre à part entière de notre famille. J’essaie de lui apporter tous les appuis qu’une mère peut apporter à sa fille pendant les neufs mois de grossesse, surtout d’ordre affectif», a témoigné Alima.

Les appuis financiers de l’Unicef, d’une somme de 100.000 ariary par mois ainsi que les kits de placement sont utilisés à bon escient pour assurer le bien-être des enfants bénéficiaires, selon les témoignages des acteurs en charge des suivis  périodiques.

Réinsertion

«Le but ultime de cette initiative, une alternative provisoire qui peut durer six mois, renouvelable en fonction des cas, serait de mettre les enfants victimes à l’abri de toutes sortes de violence, allant de la violence physique, psychologique ou encore sexuelle… tout en favorisant un environnement favorable pour leur réinsertion auprès de leur famille d’origine et élargie», a fait savoir hier le responsable su Service de district de la Population de Nosy Be, Ahya Sousana.

Dans ce cadre, des sensibilisations et des accompagnements psychosociaux sont menés au moment où les enfants victimes seraient accueillis dans des familles d’accueil. «Le dispositif famille d’accueil, également en vigueur à Antsiranana, serait développé prochainement à Toamasina et dans la capitale, mais cela nécessite plus de vigilance dans la mesure où les procédures sont délicates», a informé un responsable auprès de l’Unicef.

Fahranarison

News Mada0 partages

Business School: Iscam certifié par EFMD

L’Institut supérieur de communication, des affaires et du management (Iscam) s’est distingué en obtenant durant l’Award ceremony à l’Intercontinental hôtel de Berlin (Allemagne), son certificat «EFMD deans across frontiers (Edaf)». Cela au même titre que trois autres écoles internationales, à savoir le Collège d’administration des entreprises d’Arabie Saoudite, l’Ecole d’économie et de gestion de Beiijing (Chine) ainsi que le Colegio de estudios superiores de administracion de Colombie. La remise de ce certificat a été effectuée par l’EFMD hier au directeur général associé de l’Iscam à Ankadifotsy.

Quid de l’Edaf

L’Edaf est un programme d’accompagnement de trois ans initié par l’European foundation for management development (EFMD). Il est destiné à développer une école de management à travers un système d’évaluation international et d’un mentorat sous l’expertise d’un doyen confirmé dans le monde de l’enseignement en management. Le programme d’une durée de trois ans a permis à l’école bénéficiaire de développer de sa formation, sa pédagogie ainsi que ses infrastructures répondant  aux normes recommandées par EFMD.

L’Iscam a réussi son parcours à ce programme, ce qui lui a valu son certificat. Il convient de noter que le directeur général adjoint de l’Ecole de management de Grenoble, Jean François Fiorina, est le mentor de l’Iscam sur ce programme.

Sera R

News Mada0 partages

Nosy Bé: soutien aux candidats au baccalauréat

L’association des jeunes filles de Nosy Be «Flowers des îles» a soutenu les candidats au baccalauréat dans le district durant les cinq journées d’épreuves. Ses membres  ont préparé et distribué des déjeuners aux élèves habitant en périphérie durant les examens.

Trois cent cinquante candidats, en plus des surveillants,  ont bénéficié des repas fournis par «Flowers des îles» conduite par Hermina Kelly durant les cinq journées des épreuves du baccalauréat sur l’île de Nosy Be. L’éloignement du lieu de résidence du candidat par rapport au centre d’examen a été le seul critère exigé aux bénéficiaires identifiés par un responsable de la circonscription. Des tickets alimentaires distribués à la fin des épreuves de la matinée ouvrent l’accès à la grande salle de l’Ecole des Frères où les repas sont servis par les jeunes filles de l’association.

Le préfet Sabattin Rabenandriamanitra a félicité ces généreuses jeunes filles de Nosy Be de cette organisation répondant aux besoins des parents durant ces examens.

Manou

 

News Mada0 partages

Chronique: coulissante l’échelle des peines

Les décisions judiciaires pour assoir leur autorité bénéficient de la protection du principe qui interdit de les commenter. Parfois les gens  ne respectent les verdicts qu’à la façon d’accepter des coups du sort, et qu’à défaut de les comprendre ils leur accordent une considération à l’égal celle que ils souffrent les fantaisies de la fatalité. Des réactions qui ne constituent pas les conditions idéales pour établir un rapport de confiance entre citoyen justiciable et institution judiciaire, pourtant l’unique rempart de la population et de la société contre les violences de l’iniquité.

Les magistrats en leur âme et conscience se réfèrent au droit selon leur appréciation des faits pour porter leur jugement en conséquence. Le public ne perçoit pas toujours une cohérence à l’intérieur de certains verdicts, à fortiori lorsque il recherche cette cohérence au travers plusieurs décisions judiciaires. Tout le monde ne voit pas nécessairement la même évidence, celle-ci ne s’impose identique à tous malgré ce que laisse entendre sa définition. Un même inculpé (prévenu ou accusé) peut paraitre d’évidence innocent des actes aux yeux des uns et d’évidence coupable pour d’autres, seules les décisions judiciaires ont autorité pour établir la vérité, encore que si la dépravation des mœurs ne vienne corrompre le système.

Les magistrats pour décider d’une sanction disposent d’une échelle de peines, parfois on a l’impression que de cette échelle ils s’en servent à la manière de glisser un pied-à-coulisse, entre micron et grand écart. Deux prononcés concomitants de jugement de deux tribunaux correctionnels différents viennent quelque peu de déstabiliser l’opinion en conclusion d’affaires médiatisées. Cinq ans de prison sanctionnent la gravité d’un délit, un sursis couvrant l’intégralité de la peine non seulement en allège l’exécution mais semble atténuer la gravité de l’infraction retenue, le public peine à faire la part d’une cohérence entre ces nuances. Pareillement dans l’autre affaire qui traite d’un usage de faux et autre sorte d’escroquerie familiale, où conjuguer des milliards avec un an de prison apparait comme une manière de couper la poire en deux d’une part entre conviction et doute en même temps que d’autre part une volonté de rappeler à l’ordre un notable et à la fois de rosser un valet.

Seule l’évidence d’une cohérence, tant dans le déroulement de la procédure que dans le contenu des décisions, garantit une justice hors influence.

Léo Raz

 

News Mada0 partages

Madagascar il y a 100 ans

Le riz, toujours le riz (2)

(Suite et fin.)

Qui a mangé ce riz ?

Celui apporté des ports du Sud, il y a trois jours, par le Persépolis, a été vendu aux enchères à des prix exorbitants, sur le Wharf même avant d’arriver en magasin, et il s’en faut de beaucoup qu’il y en ait eu pour tout le monde.

– Que la région du lac Alaotra, dépendant de la province de Tamatave, produit toujours, et a produit cette année, du riz en grande quantité. Les années précédentes, ce riz arrivait à Tamatave, dont l’approvisionnement était ainsi assuré à des prix normaux.

Cette année, pour des motifs qu’on n’est pas arrivé à bien comprendre, et au moyen de tarifs spéciaux, ce riz a été dirigé sur Tananarive qui sans doute l’a tout absorbé puisqu’il n’en revient pas un grain sur la côte.

Or l’Émyrne est par excellence le pays producteur de riz… Quid ?

– Que s’il existe réellement dans la colonie, comme d’aucuns le prétendent, des stocks suffisants de riz pour satisfaire aux besoins de la population, l’administration a le devoir, comme elle en a le pouvoir, de faire circuler ce riz, et de châtier sévèrement les agioteurs quels qu’ils soient, qui ne craignent pas d’affamer le pays.

La population entière, tant européenne que malgache, attend avec anxiété.

Mort au champ d’honneur

Le Journal Officiel de samedi dernier contient la mention suivante :

« Joachim Firinga, de Sainte-Marie, sergent au 80e bataillon de tirailleurs sénégalais. – Tombé glorieusement, le 16 avril 1917, au combat de Cerny (Aisne). »

Qui n’a connu, à Tamatave, la figure sympathique et énergique de ce serviteur dévoué de la France ? Du reste ses démêlés avec l’Administration, qui voulait le traiter comme un vulgaire Malgache, l’ont rendu célèbre. En raison des services rendus à la France par son père, en raison surtout de ceux rendus par lui, comme militaire, à l’époque de la conquête, il était fier de se dire Français et il en revendiquait le titre. Son opiniâtreté a fini par triompher de l’opposition qui lui était faire et, donnant sa vie pour la France, il a prouvé qu’il était digne de ce titre. Donc honneur à sa mémoire !

L’île de Sainte-Marie peut être justement fière de son enfant.

Le Tamatave

www.bibliothequemalgache.com

News Mada0 partages

Hevitra mandalo, resaky ny mpitsimpona akotry: taiza hatramin’izay ela izay ?

Efa latsaka anaty lalina, tototry ny fahasahiranana ny mponina vao tonga saina mikasika ny tsy firindran’ny toe-draharaha noho ny fitantanana ve ny fitondrana ? Efa ela anefa izay nidradradradran’ny mponina izay sady tsy manana olona itarainana no tsy misy andry afaka iankinana. Ny sasany mody marenina, ny hafa mody mahita toy ny hoe zava-baovao ny fitombon’ny hetraketraky ny tsy fandriampahalemana sy ny onjan’ny fisondrotry ny vidim-piainana. Ao koa ny ady amin’ny kolikoly, fa resaka hafa iny. Antony manokana no itadiavan’ny governemanta isarihana ny fitarihana ny ady amin’io fanetriben’

ny firenena io. Be tabataba no be lazao tato ho ato ny Bianco ka te hitraka sao difotra noho izay ny governemanta. Diso toerana anefa izy ao anatin’io sehatra io. Toy ny rehetra ny mpitondra, samy arahi-maso avokoa. Ny andraikiny aza tsy efany ka ahoana moa no  mbola hiamboany hiloloha anjara roa mifanipaka, sady ho mpanara-maso no arahi-maso? Ny tena adidiny no mendrika imasoana. Ny fitadiavana fandrefesana amin’ny fitomboan’

ny tsy fandriampahalemana sy amin’ny fisondrotry ny vidim-piainana. Nilatsaka iny ny kabary ary niseho ny famoretana tànan’akanjo. Andrasana ny manaraka. Ela no nahenoana ny vava sy nahitana fihetsiketsehana. Ny manaraka no andrasana sao dia sanatria ny fomba fampisehoana izany fotsiny no nohavaozina. Eto ampiandrasana ny tohiny, tsy mahadiso no mametraka fanontaniana. Fantatry ry zalahy marina ve ny tokony hataony ? Raha fantany moa ny tokony hataony sy ny fanaovana azy, inona no nandrasany hatramin’izay ? Ny tranga miseho anefa tsy azo ho lazaina akory hoe vokatry ny natao, fa ny tsy fisiam-bokatra noho ny tsy natao na farafahatsarany noho ny tsy fahaiza-manao.

Ny vahoaka no tena latsaka an-katerena. Ny ampitso tsy misy mangirana ary tsy misy fanefitra atokisana, afaka ianteherana. Tsy mana-tsafidy afa-tsy loka amin’ny fandrovitana tsihy anio sy ny sedra mety hampitafy gony rahampitso ! Mandodona ireo maika handray fandimbiasana, efa nozakaina anefa ny vita sy ny tsy vitan’izy ireo, ny maro aminy efa nanandramana fa samy tsy nahomby. Tsy miankina amin’olona anefa ny fomba ivoahana avy ao anatin’ity boribory vetaveta ihodinkodinana mahafanina ity, fa avy amin’ny fandinihana ny tsy ho diso làlana toy ny hatrizay. Tsy hahita fiovana fa hiodinkodina ampitoerana raha tsy mbola ny mpitondra no atao tsara fehy voalohany mba tsy hahafahany hanatavy tena fotsiny sy hitetika ny hiala maina nefa nandentika ny vahoaka any an-davaka no namarina ny firenena any an-kady.

Léo Raz

News Mada0 partages

Us et coutumes: si le disparu l’avait su

Selon la volonté de Régis Gizavo, sa famille a refusé la décoration à titre posthume que les autorités politiques se préparaient à décerner au grand musicien. Dans le même ordre il aurait sûrement manifesté une opposition à ce que l’on décrète une journée de deuil national en sa mémoire. Mais pas plus que toute personne sensée il ne pouvait imaginer un tel opportunisme pour exploiter à l’extrême un décès, on dirait des nécrophages. Sans rien enlever aux valeurs du disparu, l’évènement de son décès ne nécessitait pas une telle marque, tant d’autres faits et accidents ayant coûté la vie à des dizaines de personnes, la disparition de valeureux citoyens, tel Jean Louis Ravelomanantsoa n’ont pas fait l’objet d’une pareille initiative. Les élections sont pour demain.

Ino Vaovao0 partages

TSY FANDRIAM-PAHALEMANA AO SAMBAVA : Jiolahy iray matin’ny fokonolona, ny iray hafa mbola karohina

Toy ny zava-nitranga tao amina tokantrano iray, ny ala-tsinainy alina lasa teo, tokony ho tamin’ny valo ora tany ho any dia lehilahy roa nisaron-tava no tonga nanafika tao.

Nitondra basy vita gasy PA sy calibre 12 izy ireo tamin’io fotoana io. Tonga dia niantso vonjy avy hatrany ny tao an-trano tamin’io fotoana io ka tapitra nivoaka avokoa ny olona rehetra. Raikitra, araka izany, ny fifandonana ka maty voadaroky ny fokonolona ny jiolahy iray antsoina hoe Ebanoa tamin’izany, ny iray kosa tafaporitsaka vaky nandositra. Raha ny vaovao voaray hatraminn’izao dia mbola tsy hita ilay olon-dratsy iray ary mbola mitohy ny fikarohana hatreto.

Marihina fa ny Borigadin’Ambohangibe no manao ny fizahana sy ny fikarohana rehetra ankehitriny.

Tatianà R.

News Mada0 partages

Fitantanam-bola sy tetibola: “Hotohizana ireo fanavaozana maro”, hoy ny minisitra

Noraisin’ny mpiasan’ny minisiteran’ny Fitantanam-bola sy ny tetibola, omaly, ny minisitra vaovao, ramatoa Andriambololona Vonintsalama Sehenosoa. Am-pihavanana izany fihaonana izany, satria tsy hafa ramatoa minisitra fa zanaka an-trano ihany, efa nisahana andraikitra maro tao amin’io minisitera io nandritra ny taona maro.

Niompana manokana amin’ny fanentanana ireo mpiara-miasa ny lahateny nataon’ny minisitra, hanohizana ny asa sy ao anatin’ny fanarahan-dalàna tanteraka. Nohamafisiny ihany koa ny hanatanterahan’ny mpiasan’ny minisitera rehetra ny torolalana voasoritra ao anatin’ny Drafitrasam-pirenena ho an’ny fampandrosoana ary isan’ny nantitranteriny ny fandraisan’ny tsirairay andraikitra amin’ny ady amin’ny kolikoly. Nanome toky ary ramatoa minisitra fa hotohizana ireo fanavaozana maro samihafa napetraka hanatsarana ny asa.

R.Mathieu

News Mada0 partages

Lasa any Taolagnaro: mifampizara traikefa ny Vezo mpanjono

Niainga tany Manambolo sy Tsiribihina, atsimo andrefan’i Madagasikara, ireo mpitantana ala honko, Vezo mpanjono miisa 12, ny 17 jolay teo, nihazo an’i Taolagnaro. Anton-dian’ireo mpanjono ireo ny hifampizara amin’ny namany any amin’ny tendro atsimon’ny Nosy, amin’ny lafiny jono, fitantanana ala sy harena an-dranomasina. Tafiditra ao anatin’ny fankalazana ny Andro iraisam-pirenena ho an’ny ala honko (26 jolay) ity hetsika manokana ity, karakarain’ny fikambanana iraisam-pirenena WWF.

Tsy nandeha lakana tsy akory izy ireo, fa nandray fiara tsy mataho-dalana 4 x 4. Manodidina ny 1.500 km ny lalana nodiavina, nandalo ny morontsirak’Andavandaoka, i Salary, Ambondrolava. Teo koa ny tanànan’i Morondava sy Toliara, ny tanàna kely any Ranomay, ny reniranon’i Onilahy (lava indrindra eto Madagasikara, 870 km), avy eo nandalo an’i Beheloke sy Itampolo.

Nandritra ny lalana sy ny toerana nandalovan’ireo Vezo mpanjono lahy sy vavy, nifanakalozana ny traikefa. Nahita ny fomba tsara sy vaovao avy any amin’ny mpanjono sy mpitantana ala honko hafa izy ireo, sady nizara ny traikefany rahateo. Miisa 160 ny mpanjono nifamotoana tany Taolagnaro, nandritra ity fankalazana ity, teo ambany fiahian’ny tambajotra Mihari.

Njaka A.

News Mada0 partages

Andrianainarivelo Hajo: « Mahantra noho ny fitiavan-tenan’ny mpitondra ny firenena »

Naneho ny heviny momba ny raharaham-pirenena ny filoha nasionalin’ny antoko Malagasy miara-miainga, Andrianainarivelo Hajo. Anisan’ny nambarany ny momba ireny fotodrafitrasa samihafa ireny sy ny fahantran’ny vahoaka…

Latsaka anaty lavaky ny fahantrana lalina ny firenena noho ny fitiavan-tena, ny fitiavan-kely, ny tsy fahalalana onona amin’ny fitadiavana tombontsoa manokana, ary ny tsy fahaiza-mitantan’ny mpitondra nanomboka tamin’ny taona 2013”, hoy izy tao amin’ny tranonkalam-pifandraisana, omaly. Nohitsiny fa zary lasa tandra vadin-koditra ho an’izao fitondrana izao ny fahantrana sy fijaliana, toa iniana hapetraka.

Ankoatra izany, nambarany fa ekena tokoa ny tokony hifaliana sy hiarahabana ny fahavitan’ireny fotodrafitrasa ireny. Tena ilaina tokoa eto amin’ny firenena, mbola tena ao anatin’ny tsy fahampiana tanteraka raha resaka fotodrafitrasa hifamezivezena, toy ny làlana sy tetezana. “Na izany aza, azo avela sy hodian-tsy hita ve ny fihetsika feno fireharehana sy fiheboheboana nataon’ny mpitondra raha nitokana ny tetezan’i Kamoro ohatra izy. Mbola vola nindramina avy amin’ny mpandoa hetra vahiny namantsika anefa ny fanamboarana izany ary hipetraka ho trosa, hobaben’ny taranaka ?”, hoy ihany izy.

Firenena afaka handray an-tanana ny hoaviny

Nanteriny fa tsy afaka hirehareha sy hifaly isika fa mahavita raha tsy fotodrafitrasa napetraka vokatry ny hatsembohantsika ary naorin’ny orinasantsika no hotokanantsika. “Tena mariky ny fahavononana sy finiavana hanatratra ireo tanjona amin’ny fampandosoana sosialy sy toekarena izany. Tsy sanatria filam-boatsihary na hambopom-pirenena diso toerana izany, fa fitiavana hahita ny firenena malagasy afaka handray an-tanana tanteraka ny hoaviny amin’ny alalan’ny fahaiza-manaony sy tena fitiavan-tanindrazan’ireo mpandraharaha malagasy”, hoy ny filoha nasionalin’ny antoko Malagasy miara-miainga, Andrianainarivelo Hajo.

Synèse R.

News Mada0 partages

Notoloran’ny faritra moto ny zandary

Nahazo moto miisa fito avy amin’ny faritra Analamanga ny fari-piadidian’ny zandary Antananarivo. Natokana ho an’ireo distrika manodidina an’Antananarivo izany… « Tafiditra amin’ny fanatsarana ny fiahiana ny loza eny an-dalana sy ny fametrahana fandriampahalemana izao fanomezana izao. Tetikasan’ny faritra taona 2016, ny fampitaovana moto ary mbola hiampy avo roa heny izany ho an’ny taona 2017 mba hampihenana ny lozam-pifamoivoizana sy ny asan-jiolahy », hoy ny lehiben’ny faritra, Rakotonanahary Ndranto, tetsy Ankadilalana omaly. Nanteriny fa tsy azo atao an-tsirambina ny filaminan’ny fifamoivoizana eny an-dalana. Notsindrin’ny avy amin’ny zandary, ny Kly Ravoavy Sambatra kosa fa hampiasaina amin’’ireo lalam-pirenena (RN) sy ny fitandroana filaminana ireo moto ireo. “Aoka hohajaina ny fitsipiky ny fifamoivoizana satria raha ny antontanisa ho an’ny taona lasa, 90 mahery ireo maty. Mihoatra lavitra noho ny matin’ny asan-jiolahy sy dahalo. Mba mety hihena izany amin’ireto fitaovana azo ireto”, hoy izy.

Synèse R.

News Mada0 partages

Nolavina ny fangatahan’ny Tim: nakaton’ny prefet i Mahamasina.

Efa nampoizina. Namoaka fanambarana ny eo anivon’ny prefektiora, omaly, fa tsy azon’ny Tim hatao ny manao hetsika hankalazana ny faha-15 taony etsy amin’ny kianjaben’i Mahamasina, ny asabotsy izao. Nitohy avy hatrany amin’ny fanakatonana ity kianja ity izany.

Nitondra valin-kafatra avy hatrany ny Tim, manoloana izany. “Tsy nisy hetsika an-dalambe na fanohintohinana ny hetsika natao. Tsy nisy koa ny amboletra ary efa nahazo rariny  teny amin’ny tribonaly ny Tim… Midika fa tsy nandika lalàna izahay. Naterin’ny vahoaka teny an-tranony ny filoha Ravalomanana tamin’iny fotoana iny”, hoy ny fanambarana.  Ankoatra izany, tsy nahitana olona naratra na fivarotana vaky tamin’iny fotoana iny. Tsy nisy fiara na trano voaroba, nefa noravana tamin’ny baomba mandatsa-dranomaso. Midika io fanambaran’ny prefet manakana ny hetsika io fa fanamparam-pahefana ary tsy mitondra ho any amin’ny fitoniana, araka ny fanambarana ihany…

Tsy mifanalavitra amin’izao fepetra noraisin’ny prefet izao ny nambaran’ny HVM, andro vitsy izao. Efa tsy mivonona ny tsy hanome alalana ny mpitondra… Anjaran’ny mpanao politika rehetra ny mandinika, manomboka eto.

Synèse R.

News Mada0 partages

“JO 2024”: efa azo antoka ny fandraisan’i Paris

Karazany niverin-dalana ihany i Los Angeles amin’ny fandraisana ny “Lalao olympika 2024” manoloana an’i Paris. “Mety ho sarotra ny hanatanterahana izany…”, hoy ny ben’ny Tanànan’i Los Angeles, Eric Garcetti, manomboka tsy hanisy teny intsony ny momba ny “JO 2024”, raha ny filazany tamin’ny 26 jolay teo.  Saingy, tsy milefitra kosa io tanàna iray lehibe any Etazonia io ny amin’ny ady ataony amin’ny fandraisana ny “JO 2028”.

Azo heverina fa ho tanteraka ihany izany ny nofinofin’i Paris, raha manomboka mazava ankehitriny ny safidin’i Los Angeles, mpifaninana tokana aminy. Efa niady mafy ary tsy milefitra amin’ity faniriany ity rahateo ny Renivohitra frantsay. Raha fintinina izany, karazany tsy mpifaninana intsony i Los Angeles ho an’ny “JO 2024”. I Paris irery ihany sisa eo amin’izany toerana izany, ary mazava, tsy hisy ankamantatra intsony ny fifidianana hatao any Lima, Pérou, ny 13 septambra ho avy izao.

Amin’izao fotoana izao ary, efa mitodika any amin’ny “JO 2028” ny Amerikanina. Afaka volana vitsivitsy monja, hoporofoin’io tanàn-dehibe iray any Etazonia io amin’ny komity olympika ny fahavononany sy fahafahany mandray izany lalao izany. Hojeren’ny komity olympika sy hanaovana tomban’ezaka dieny izao ireo fomba rehetra naroson’i Los Angeles ho an’ny “JO 2024” raha azo hotanterahina amin’ny 2028. Iza aty Afrika ary ny efa mba mikajy handray ny “JO 2032” ?

R.Mathieu

News Mada0 partages

Fanapahan-kevitra hafahafa: teny malagasy, hoenti-mampianatra hatreo amin’ny ambaratonga fototra

Nisy nihaino ihany ireo hevitra natsipy tetsy sy teroa ! Aoka mba ho amin’ny teny malagasy ny teny hoenti-mampianatra ny zaza malagasy. Nivoaka tamina fampahalalam-baovao maro fa hatreo amin’ny taona faha-9 no hanatanterahana izany. Fanapahan-kevitra nanaitra sy nahagaga ary nahatalanjona… Nibosesika indray ny fanontaniana !

Nanomboka tamin’ny nahitana fa tsy nahomby ny fampiharana ny « fanagasiana sadasada » teo amin’ny fampianarana, tsy nitsahatra ny nitady vahaolana ny mpampianatra sy ny mpikaroka maro. Niombonan-kevitra ny hampianarana ny zaza malagasy amin’ny teny malagasy. Teny malagasy no hoenti-mampianatra. Tsy tanteraka anefa izany raha tsy amin’izao fotoana izao, araka ny fanapahan-kevitry minisitera telo (Fanabeazam-pirenena, Fampianarana ambaratonga ambony, Fampianarana teknika).

Hatreo amin’ny ambaratonga fototra, teny  hoenti-mampianatra ny teny malagasy. Fa maninona no najanona hatreo amin’ny ambaratonga fototra ? Miofo ka tonga « vazaha » angaha ny zaza malagasy iray rehefa hiditra any amin’ny « lycée » ka tsy hahazo resaka amin’ny teny malagasy ? « Ny olom-pirenena nobeazina tamin’ny teniny no afaka mitondra fampandrosoana ho an’ny taniny ». Odiana tsy fantatra ve io lamina voajanahary ambaran’ny Unesco io ?

Lasa lavitra raha ampianarina amin’ny teniny

Mibosesika, tahaka izany, ny fanontaniana taorian’ity fanapahan-kevitra « hafahafa » ity. Nahoana izy raha notohizana hatrany amin’ny ambaratonga ambony. Tsy misy, na trangan-javatra iray aza, tsy azo hazavaina (io ilay hoe, teny hoenti-mampianatra) amin’ny tenindreny. Lainga sy anisan’ny fitaka natao nandritra ny fanatanterahana ny « fanagasiana sadasada » ny filazana fa « tsy azo gasina ny taranja siantifika ». Tsy ny taranja no tokony ho « gasina » fa ny teny hoenti-mampianatra no atao amin’ny teny malagasy. Ny Sinoa, ampianarina matematika, fizika, sivilizasiona, informatika, sns, amin’ny teny sinoa ka nahoana ny Malagasy no ampianarina ireo amin’ny teny « vazaha » ?… « Paikadim-bazaha no nahatonga an’izany. Lasa lavitra ny firenena iray raha ampianarina amin’ny teniny ny mponina ao aminy », hoy ny mpampianatra iray izay!

Nanao dingana ny tompon’andraikitry ny fampianarana ny amin’ny fampiasana ny teny malagasy ho teny hoenti-mampianatra. Tsara, saingy tsy ampy raha hatreo amin’ny ambaratonga fototra ihany. Raha katsahina tokoa ny fitiavan-tanindrazana, mila tohizana hatrany amin’ny ambaratonga ambony io fanapahan-kevitra io.

HaRy Razafindrakoto

News Mada0 partages

« Je brûle encore »: mitatitra ny fivaivain’ny fiainana any atsimo

Nivoaka ny boky mitondra ny lohateny hoe « Je brûle encore », nosoratan’ilay mpanoratra mitondra ny anarana hoe Ben Arès, teratany frantsay, saingy monina any Toliara efa ho maherin’ny folo taona izao. Nanonta ny boky kosa ny trano fanontana Dodo Vole.

Angom-baovao na « recueil de nouvelles » ity boky ity. Vaovao tsy mitovy amin’ny fahita sy famaky ary fandre anefa izany, satria mitantara ireo tranga any ambanivohitra lavitra any Toliara any, toerana tsy misy mpijery loatra. Manome sehatra anehoan-kevitra ho an’ireo tsy mba afaka manao izany ity boky ity.

Araka izany, misongadina ao ny fahasahiranana iainan’ny mponina andavanandro sy ny fivaivain’ny adim-piainana ao anatin’ny toe-tany maina sy ny toetr’andro migaingaina. Na eo aza ny mahangom-baovao ity boky ity, nezahin’ny mpanoratra nofehezina ny maha kanto ny asa sorany.

Miezaka mamoaka boky tsy voatery hampidi-bola, saingy mampahafantatra bebe kokoa an’i Madagasikara ny trano fanontana Dodo Vole, araka ny nambaran’ny mpitantana izany. Anisan’ireo boky nosafidina manokana amin’izany ity boky nosoratan’i Ben Arès, misy 104 pejy, ity.

Landy R.

News Mada0 partages

Ao anatin’ny Randrantelo ihany: “Tanteraka ny fikasako handeha irery”, hoy i Farakely

Randrianarivo Fara no tena anarany. Noho ny fisian’ny Fara roa tao amin’ny tarika Randrantelo, lasa raiki-tampisaka ny hoe Farakely. Sary miraikitra amin’izay anarana izay koa ilay feo feno angola… Hiditra amin’ny dingana iray vaovao i Farakely. Resadresaka.Gazety Taratra (*): Efa elaela ihany no fantatry ny mpankafy mozika ilay hoe Farakely. Azonao tantaraina fohy ve ny niandohanao tanatin’ny mozika?

Farakely (-): Ny ray aman-dreniko no tena nanao mozika taloha. Notarihiny sy nampianariny izahay zanany. Somary notereny mihitsy aza, satria teo amin’ny sivy na 10 taona teo aho tamin’izany. Tsy nisy niditra ny loha akory izany do, re, mi, fa, sol, la, si izany… Taty aoriana niditra tamina antoko mpihira, ka nahitako ny tsiron’ireo nianarana taloha tao.Tany am-boalohany tsy nifankatia loatra izaho sy ny mozika ary tsy mba nihevitra ny ho lasa mpihira izany mihitsy aho tamin’izany.

* Nahita tsirony izany I Farakely teo. Nanomboka oviana moa no tena niroboka tanteraka ao anatin’ny mozika? – Nandray anjara tamina fifaninanan-kira izay izaho sy i Laza. Nanomboka nitsapatsapa ny halalin’ny rano aho teo. Izahay mianadahy rahateo efa niara-notaizain’i dada tao anaty mozika, ary ohatra ireny antoko mpihira kely ireny mihitsy izahay tao an-trano. Marihiko fa efa ela izahay mianadahy no niara-nihira, ary nitohy tao anatin’ny antoko mpihira izany. Tsy nisy nahafantatra loatra anefa izay, fa tao anatin’ny tarika Randrantelo aho no tena fantatry ny maro.

* Fanontaniana manitikitika ny maro ity: I Farakely ve mbola ao anatin’ny tarika Randrantelo?

– Tena mbola ao mihitsy ao. Tao anatin’ny Randrantelo aho no tena nahita sy niaina ny mozika sy nilomano ao anatin’io tontolo io. Tena nitondra zavatra maro ho ahy ny tarika ary azoko lazaina fa nahazoako traikefa voalohany tao…

* Ny mahatonga ny fanontaniana mantsy, efa hitan’ny mpankafy ny rakitsarinao mandeha irery sy ireo miaraka amin’i Laza. Hanao ahoana ny tohin’ny tantara?

– Araka ny efa fantatry ny mpankafy, nirona amin’ny famerenana hiran’olona ny tarika Randrantelo, na manana hira vitsivitsy anay manokana aza izahay. Hafa ny ao anatin’ny tarika, saingy misy tanjona hafa mihitsy koa mba napetrako hizara mozika tiako manokana. Raha toa ka somary hira taloha no ataon’ny Randrantelo, ny ahy manokana iriko ho mozika somary tanora kokoa. Somary milokoloko koa…Lasa tanteraka ihany izany fikasana handeha irery izany ankehitriny, ary ao anatin’ny fikarakarana izahay izao.

– Manam-baovao tsara hozaraina izany i Farakely?– Eny. Hanao fampisehoana ao amin’ny CCEsca Antanimena aho, ny 18 aogositra ho avy izao. Seho voalohany iarahako amin’ireo mpankafy, sady fotoana hamoahana ny rakikira voalohany ihany koa. “Tafaray isika roa” ny lohatenin’io, araka ilay hira efa manomboka hain’ny rehetra iny. Eo am-pamaranana tanteraka izahay izao.

Nangonin’i Zo ny Aina Randriatsiresy

News Mada0 partages

Vonoan’ olona tany Brickaville: tovolahy tsy ampy taona voaheloka roa taona an-tranomaizina

Hentitra ny fitsarana na nisy karazana famindram-po ihany aza, tamin’ny didy navoakany ho an’ity tovolahikely voampanga ho namono olona. Voaheloka roa taona an-tranomaizina sazy mihatra izy io.

Tovolahy vao 16 taona monja no voaheloka roa taona an-tranomaizina noho ny vonoan’olona. I Leocady Resie André, antsoina hoe Babasa, sy Rafanomezantsoa Noelson, antsoina hoe Noely, Dimilahy Roger Félix ,antsoina hoe Lava, ary laro Sampilahy Bruno ireo voampanga. Ireto roa  farany izay 15 taona tamin’ny nitrangan’ny olana ary 16 taona izy amin’ izao fotoam-pitsarana, ny 25 jolay lasa teo izao. Raha iverenana ity raharaha nahavoasaringotra tovolahy kely vao 16 taona , vonoan’ olona niseho tao amin’ny kaominina ambanivohitra Lohariandava, distrikan’ i Brickaville ny 14 septambra 2016. Maty tamin’ izany i Jean Marc, izay evanjelista amin’ny finoana iray avy amin’ ireo sekta ao an-toerana.

Raha ny fanazavana sy ny fifandaharana teo amin’ny voampanga sy ny mpiaro voampanga ary ny mpitsara mpamoaka didy, andaniny, ny fampanoavana ambony, resaka ady vehivavy ny raharaha.  « Tany amin’ny trano fandihizana iray ao an-tanana izahay ary nisy vehivavy iray lazain’ingahy evajelista fa sakaizany izay niresaka tamiko ka tezitra izy. Nivoaka ny trano fandihizana aho, nanaraka ahy avy tao aoriana anefa ilay evanjelistra ary nitondra vy teny an-tanany, namely ahy izy, saingy tsy nahavoa, ary azoko ny vy teny an-tanany ary naveriko taminy ka nahafaty azy », hoy ny fiarovantenan’i Dimilahy Roger Felix, 16 taona, tamin’ny fotoam-pitsarana azy. Ity farany izay nilaza ihany koa fa tsy misy idiran’ ireo voampanga miaraka aminy ny raharaha fa adin’ izy sy ilay evanjelistra ihany.

Vokany, taorian’ny fandinihan’ny mpitsara mpamoaka didy sy mpanampy azy, nilatsaka ny didy misy fampihenan-tsazy noho izy tsy ampy taona ary ny tsy fandavany fa niaiky ny heloka vitany izy.  Teo ihany koa ny hoe fiarovan-tena nataony saika novonoin’ ilay evanjelistra ka roa taona an-tranomaizina azon’ ity tovolahy tsy ampy taona ity. Marihina fa efa notanana am-ponja vonjimaika izy talohan’izao ary efa manala ny ambiny nitanana azy am-ponja sisa.

Sajo sy Yves S.

News Mada0 partages

Port Berger: taksiborosy nifandona, nahafaty olona roa

Taksiborosy roa, fiara karandalina sy Mazda iray, nifandona tany Port Berger, omaly hariva, ka nahafatesana olona roa. Olona maro hafa ihany koa naratra vokatr’izany tao amin’ity fiara kely. Mbola nosokirina tao anaty fiara ireo naratra rehetra sy ireo olona roa maty. Araka ny vaovao avy any an-toerana, samy nandeha mafy ireo fiara roa ireo ka tsy tafala intsony rehefa sendra teo amin’ny lalana somary miolana. “Mafy ny fifandonana, ary nirefotra be ny fidonana. Nipitika mihitsy ilay Mazda raha tafala lalana ilay kamiaobe”, hoy ny avy any an-toerana.

Tonga teny an-toerana ny zandary nizaha ity loza ity. Nentina haingana tany amin’ny hopitaly kosa ireo naratra. Notanana nanaovana famotorana ny mpamily ilay karandalina. Mampitandrina ny rehetra ny mpitandro filaminana amin’ny tokony handehanana mora amin’izao mahabe ny olona mandeha any amin’ny faritany izao. “Samia mitandrina sy mifanaja ny rehetra, tsy ho maimaika fa izay tonga soa ihany no arahabaina. Izay ihany no fomba hisorohana ny loza”, hoy ny mpitandro filaminana.

Yves S.

News Mada0 partages

Bongolava: olona roa matin’ny dahalo

Olona roa indray maty voatifitry ny dahalo nandritra ny fanafihan-dahalo tao Fierenena afakomaly. Lasan’ireo dahalo nandritra ny fanafihana ny omby miisa 50 teo ho eo. Mitaraina ny mponina fa tao anatin’ny herinandro izay, manao ny ataony ny dahalo ao Bongolava. Tao Ambatomainty lasan’ny malaso  ny omby anjatony. Miverina fotsiny ireo mpanara-dia noho ny fahasarotan’ny lalana sy ny fiparitahan’ny dian’omby.

Toy izany koa ny tao Firavahana, omby ampolony no lasan’ny dahalo, afakomaly alina ihany. Nanao izay ho afany tamin’ny fanarahan-dia ny zandary sy ny fokonolona, saingy tsy tratra ireo dahalo. Nitrangana asan-dahalo toy izany koa tao Ambohidrangory, afakomaly alina ihany. Efa tafaverina amin’ny tompony anefa ireo dahalo noho ny ezaka nataon’ny mpitandro filaminana sy ny fokonolona. Manao izay ho afany ny zandary amin’ny famongorana ny asan-dahalo, saingy tsy kely lalana ny ratsy. Manginy fotsiny ireo dahalo ambony latabatra miray tsikombakomba amin’ireo tena manao ny asa ratsy.

J.C

News Mada0 partages

Nametraka taratasy fangataham-pamelana izy ireo: naverin-dry zalahy ilay lakolosy nangalariny efa ho herint...

Tena niova fo sa tsy nahita mpividy ? Naverin’ireo  mpangalatra omaly vao maraina ny lakolosin’ny fiangonana iray ao Morombe faritra Atsimo Andrefana, very efa ho herintaona lasa izay. Araka ny fampitam-baovao voaray avy any an-toerana, olona teo an-tanàna ihany no nahita ilay lakolosy ka rehefa nojerena dia hita fa ilay lakolosin’ny fiangonana iray ao an-toerana efa very herintaona lasa izay ity nisy namerina ity. Tsy vitan’izay fa nandefa taratasy fifonana sy fangataham-bavaka avy amin’ireo mpino ao amin’ny fiangonana nangalaran’izy ireo ilay lakolosy ireo mpangalatra. Nataon’izy ireo tao anatin’ilay lakolosy ilay taratasy fifonana. “Indro ny fananan’ny Tompontsika averina Aminy ary aoka anie ny Tompo homba anay. Hitanay fa tsy mety ny nataonay ka izay no nahatonga izao fanatitra (ilay lakolosy io) izao ka mivavaha ho anay mpanota”, hoy ny soratra nampiarahin’ireo mpangalatra tamin’ilay lakolosy.

Nahazo vahana ny halatra lakolosy tany amin’ny faritra Morombe Toliara tamin’ny taon-dasa. Lasibatr’ireo mpangalatra tamin’izany ny lakosolosin’ny fiangonana Katolika. Lasa nirona tany amin’ny lakolosy indray ny ankamaroan’ireo dahalo ka somary nihena ny halatr’omby. “Efa nibebaka tamin’ny Tompontsika izahay, nefa mangataka vavaka aminareo koa. Manaiky eo anatrehan’ny Tompo izahay fa tsy hamerina intsony”, hoy hatrany ny soratra nataon’ireo mpangalatra ao anatin’ilay taratasy fifonana.

Somary nilamindamina indray ny halatra lakolosy tato anatin’ny volana vitsivitsy izay. Efa nanaovan’ny fivondronamben’ny Eveka antso avo rahateo tamin’ny tompon’andraikitra mba hijery akaiky ity raharaha halatra lakolosy ity.

J.C

News Mada0 partages

AVG: niakatra fitsarana ny mpandrindra teo aloha

Niakatra fitsarana ny talata 25 jolay teo, ny mpandrindra nasionaly teo aloha ny fikambanana Alliance voahary gasy (AVG), Ralamboson Andriamanga Andry. Raharaha iray amin’ireo efatra iampangana azy io hatrehiny io, noho ny fanararaotam-pitokisana sy fanodikodinam-bola tao amin’ny AVG. Efa voatazona tany am-ponja, nanomboka ny 20 febroary teo ny tenany, ary izao vao hiatrika ny fitsarana.

Hiakatra fitsarana koa izy, ny alatsinainy 31 jolay izao, mikasika ny raharaha faharoa maha voarohirohy azy, ary mbola misy ny roa hafa. Nilaza ny filohan’ny filankevi-pitantanana ny AVG, Razakamanarina Ndranto, fa matoky ny fahendren’ny fanjakana sy ny vesatra hiampangana ny mpitantana teo aloha ity fikambanana miaro ny tontolo iainana ity.

Randria

News Mada0 partages

Hifarana amin’ny fanatanjahantena ambava: hanomboka ny alatsinainy ny fitsarana ny bakalorea

Hifarana, anio, ny fanadinana bakalorea amin’ny taranja adina am-bava amin’ny taranja fanatanjahantena ho an’ireo tsy nanatrika ny « pratique » noho ny antony manokana. Navondrona eny amin’ny foibem-panadinana lycée Ampefiloha avokoa ireo mpiadina 1 800 eo ho eo hanatanteraka izany. Omaly, ho an’ny tapak’andro maraina, nanao ny taranja français ny mpiadina ary mbola niverina ny hariva ny sokajy A nisafidy ny taranja sciences naturelles sy ireo nisafidy ny sokajy C sy D. Nanontany ny mpanara-maso fanadinana ny mpiadina raha afaka mampiasa antontan-kevitra ivelan’ny laza adina sciences naturelles. « Tsy nahazo toromarika momba izany ny mpiandraikitra fanadinana ka tsy azo nikirakira izany izy ireo », hoy ny fanazavana. Azo ambara fa nilamina ny fizotry ny tontolo andro omaly, ho an’ny foibem-panadinana lycée Ampefiloha manokana.

Amin’ny alatsinainy vao manomboka ny fitsarana ny laza adina rehetra satria ny asabotsy vao tonga daholo eto Antananarivo ny kopia avy any amin’ny toerana lavitra toy ny any Mandoto…

« Miaraka atao ny fitsarana ny kopia rehetra isaky ny taranja ary mbola misy ny fivoriana ametrahana ny « grille de correction » iraisana hanamorana ny asa, hoy ny fanazavan’ny lehiben’ny Ofisin’ny bakalorea eto Antananarivo », omaly.

Vonjy A.

News Mada0 partages

“Smile Party”: hanjaka ny feo sy ny jiro

“Smile Party”, fotoana ifanomezan’ireo tanora, isaky ny vita fanadinana bac. “Smile Party”, hetsika mitondra fivoarana hatrany, isan-taona. Fanamby goavana indray no hapetraky ny “RDJ’s Team” amin’ity andiany ity: fetibe hanjakan’ny feo sy ny kilalaon-jiro.Efa miatrana etsy amin’ny lapan’ny Fanatanjahantena Mahamasina ireo fitaovana raitra sy miavaka, fanamafisam-peo, ravaka ary kilalaon-jiro isan-karazany. “Efa vonona any amin’ny 95% any izahay fa miandry antsika hifety rahariva sisa”, hoy ny nambaran’i Teejay Jerry; omaly.Mpikosoka kapila 15 no hifandimby hanafana ireo toeram-pandihizana rehetra ao amin’io. Hitarika izany ireo efa teo hatramin’izay andiany 13 izay, toa an’i Jaytaxx sy Dj Denis. Eo koa ireo taty aoriana toa an-dry Dj Kiero, Shinchan, Cyemci, Dj Gova, Sizzla Dj, MPX, Teejay Jerry, Kikoo, Looping, Raerz, Three T, Scotty Raz ary Cool Mix. Ankoatra ireo, hisy koa ny seho hataon’ireo mpanakanto toa an’i Arione Joy, Andriann, Rak Roots, Mr Sayda, Melanie Walker, Jess Flavi One, Meizah ary Juini.

Zo ny Aina

Ino Vaovao0 partages

MAHATSINJO-ANTSALOVA : Nodoran’ny dahalo ny tanàna, trano miisa sivy levon’ny afo

Raha ny zava-nitranga afak’omaly maraina tao amin’ny tanàna atao hoe Mahatsinjo ao amin’ny Kaominin’i Bemaraha Atsinanana, Distrikan’Antsalova dia nodoran’ireo malaso ny tanàna rehefa avy nanatanteraka fandrobana izy ireo.

Araka ny loharanom-baovao voaray dia andiany maromaro ireo olon-dratsy no niaraka, ka isaky manafika tokantrano dia mampiasa fitaovana sy zava-maranitra izy ireo ka midaroka avy hatrany. Manoloana izay dia tovolahy anankiroa no vaky loha nandritra ny fanafihana. Marihina fa tapitra tanteraka ny omby ao amin’io tanàna io ankehitriny, raha ny tatitra voaray. Rehefa azon’ireo dahalo izay nilainy dia nodorana indray ny tanàna iray manontolo ka trano miisa sivy no kila forehitra tsy nisy azo noraisina intsony.

Tsy afa-nanohitra ireo fokonolona nanoloana ny zava-misy satria betsaka ireto mpandroba no niaraka, etsy andaniny ny tsy fisian’ny mpitandro filaminana tao an-toerana, tamin’io fotoana io. Marihina anefa fa misy “Poste avancé” an’ny Zandary ao amin’ity tanàna ity ary efa misy trano azo ipetrahan’ny Zandary, ka efa nisy ny taratasy fanendrena an’ireo tokony hiasa ao. Ny nahagaga anefa dia tsy nahitana Zandary mihitsy nandritra ny fifandonana.

Raha ny filazan’i Amir Sebastien Chebany Ben’ny tanàna momba ny raharaha dia nanomboka tamin’ny 15jolay no niala teo an-tanàna ireo Zandary ireo, ka mbola tsy tafaverina hatramin’izao. Raha ny tokony ho izy anefa dia tsy nahazo niala tao izy ireo raha tsy misy solony satria efa nahazo fepetra tamin’ny Solombavambahoakan’Antsalova Ramarolahy Maurice. Mandeha ny fanadihadiana rehetra amin’izao fotoana izao raha ny tatitra voaray ihany. Raha tsiahivina mantsy dia efa may nodoran’ny dahalo ihany koa ity tanàna ity tamin’ny taona 2013.

Ny tena manahirana amin’ny fiadiana amin’ny asan-dahalo dia ny fahalavirany satria 50km miala an’Antsalova no misy azy. Manampy trotraka ny tsy fahafahan’ny fiara na moto noho ny faharatsian’ny lalana. Izany hoe tsy maintsy mandeha an-tongotra adiny sivy any ho any vao tonga any amin’io toerana io. Manao antso avo amin’ny fitondram-panjakana ireo mponina mba hijery ifotony ny zava-misy satria lasibatry ny malaso izy ireo ka very fananana sy very hevitra hatramin’izao.

Andrasana hatreto ny valin’ny famotorana sy ny fandraisan’andraikitry ny mpitondra fanjakana manoloana ireo tsy manan-kialofana noho ny hetraketraky ny fanafihana ataon’ireto olon-dratsy.

Tatianà R.

Ino Vaovao0 partages

POLITIKA - FAMPANANTENAN’NY PRAIMINISITRA : Hitohy ny fitakian’ny SMM raha tsy misy vahaolana maharitra

Anisany nanome tosika ireo mpitsara tamin’ny fiverenan’izy ireo handray ny asany ny fampanantenana nataon’ny Lehiben’ny governemanta. Nilaza tamin’izany ny Praiminisitra Mahafaly Solonandrasana Olivier fa hijerena ny vahaolana maharitra ny fitakiana ataon’ny sendikan’ny mpitsara eto Madagasikara io.

Miara-mifanome tanana amin’izay fikarohana ny marimaritra iraisana izay ny minisiteran’ny Fitsarana, ny eo anivon’ny Primatiora sy ny tompon’ny fitakiana.Hatreto anefa dia nambaran’ny SMM mazava tsara fa mbola mijanona ho kabary ambony latabatra sy fampandriana adrisa fotsiny ny azon’izy ireo satria mbola tsy tena hita izay fampiharana mivantana izay vahaolana naroson’ny Fanjakana.

“Raha tsy misy valiny ireo zavatra nangatahinay dia tsy maintsy mbola mitohy ny fitakiana”, hoy ny filohan’ny sendikan’ny mpitsara eto Madagasikara, Fanirisoa Ernarivo. Nambarany ihany koa fa efa nisy ny fitakiana izay efa natao tamin’ireo fahefana mpanatanteraka, ka aorian’ny fanapahan-kevitra horaisin’izy ireo no ahalalana na nekena izany na tsia. Ankoatra izay voalazany ihany koa fa tao anatin’izay andro maromaro tsy nandrenesana azy izay dia nandeha niatrika fiofanana tany ampitan-dranomasina ny tenany.

Nisy tamin’izany ny fihaonany tamin’ireo mpitsara vahiny, no mbola nampahafantatra ny zava-misy iainan’ny mpitsara Malagasy tamin’ireo mpanao gazety vahiny ihany koa izy.

Avotra Isaorana

Ino Vaovao0 partages

BAOLINA KITRA : Notoloran’ny Lehiben’ny Faritra kojakoja ny FC Iarivo Maroantsetra

Ny alahady 30 jolay izao izy ireo no hifandona amin’ny ekipa Fc Fosa avy any Antananarivo.

Efa ao anatin’ny fanomanana fatratra ny Fc Iarivo. Ho fampirisihina, dia nisy ny fanomezan’ny Lehiben’ny Faritra Analanjirofo kojakoja izay nahitana fanamiana, godasy ary baolina ho azy ireo. Ny Lehiben’ny Faritra Analanjirofo Ramaroson Jacques izay sady filohan’ny ligy baolina kitra Analanjirofo. Mbola izy ihany koa no filohan’ny ligy 22 eto Madagasikara.

Nanotrona azy tamin’ny fanolorana kojakoja ho an’ny Fc Iarivo izao ny minisitry ny Tontolo iainana, Ndahimananjara Johanita. Ity farany izay zanaky ny Distrikan’i Maroantsetra rahateo.

Kamy

Ino Vaovao0 partages

MANDRITRA NY FIALAN-TSASATRA : Maro ireo hetsika ara-kolontsaina any Mahajanga

Maro ny hetsika hokarakarain’ny mponina sy ny tompon’andraikitra any an-toerana mandritra izany hisy ny fety hataon’ny mpanakanto maro any amin’ireo toeram-pilanonana maro any an-toerana amin’izany toa an-dry Elidiot, Eric Manana, Jerry Marcoss….

Fa  ankoatra izay ihany koa dia efa tsy maharaka intsony ireo efitra fandraisam-bahiny any an-toerana amin’izao, ka misy amin’ireo olon-tsotra no mampanofa trano ireo vahiny tonga any an-toerana. Ny mpitandro filaminana ihany koa dia efa mandray andraikitra amin’ny fanaraha-maso ny manodidina sy miambina ireo toerana be mpitsidika sy be olona.

Mihaja Sarobidy

Ino Vaovao0 partages

AMBATOVY : Misandratra eo amin’ny tsena iraisam-pirenena na dia nilatsaka aza ny vidina nikela

Mbola nijanona manodidina ny 10 000 dolara isan-taonina izany nandritra ny telo volana voalohany tamin’ity taona ity ary tsy manantena ny mety ho fihatsaran’ny toe-draharaha loatra ireo mpanidnika ato ho ato.

Mbola ho sarotra, araka izany, ity taona 2017 ho an’ireo mpamokatra nikela toa an’Ambatovy. Ilaina tokoa ny fametrahana tetikady mahomby sy mirindra ho famehezana ny fandaniana mba hiantohana ny fitohizan’ny asa sy hisorohana ny fatiantoka. «  Ny ho sangany eo amin’ny famokarana nikela sy kôbalta tsara kalitao eo anivon’ny tsena iraisam-pirenena no vinan’Ambatovy. Tanjonay ny ho isan’ireo orinasa mpamokatra manana mason-karena ambany indrindra eo aminn’ny tsena iraisam-pirenena  », hoy ny Filoha an’Ambatovy, Tim Dobson. 

Tsy maintsy ahena ny sandan’ny famokarana ary hampiakarina ny tahan’ny vokatra mba hanatrarana izany tanjona izany. Ilaina noho izany ny fametrahana fepetra hentitra hifehezana ny fandaniana sy fomba fiasa mihatsara hatrany, izay mitondra amin’ireo fomba fanao eran-tany eo amin’ny lafiny rehetra amin’ny asanay, hoy hatrany izy. Ny fampiakarana ny famokarana dia mampihena ny sandam-pamokarana ny nikela isaky ny taonina. Avo dia avo ny fandaniana efa voafaritra tsy maintsy ataon’Ambatovy mandavan-taona. Izany hoe ny vola tsy maintsy laniana ho fanohizana ny asa na kely na be ny taham-bokatra. Namokatra nikela 42 000 taonina Ambatovy tamin’ny taona 2016 ary heverina ho maherin’ny 47 000 taonina izany amin’ity taona ity, tanjona izay mifanindran-dalana amin’ny fampiakarana ny tany kirakiraina eo amin’ny toeram-pitrandrahana amin’izao fotoana izao.

«  Tsy ho anay ihany no tena manan-danja ny fitohizan’ny asa tanterahin’ Ambatovy fa ho an’i Madagasikara ihany koa, firenena mampandroso an-trano anay, satria Ambatovy no mpisehatra lehibe indrindra eo anivon’ny toekaren’ny firenena ary fitaratra eo amin’ny fampandrosoana izany toekarena izany amin’ny ho avy  », hoy Tim Dobson.

INVT

Ino Vaovao0 partages

FIANARANTSOA : Nitokona ireo mpamboly voaloboka mpamatsy ny orinasa Lazan’i Betsileo

Raha ny fanazavana voaray avy any an-toerana dia efa tamin’ny taona 2015 ireo vondron’ny mpamboly ireo no tsy nandray vola vidim-boaloboka, ka izany no antony mahatonga ny fitokonana. Marihina fa tantsaha manodidina ny 600 eo ho eo no voalaza fa voakasik’ity raharaha ity. 

Manoloana izay àry dia manome fe-potoana 15 andro izy ireo hamahan’ny orinasa ny olana mianjady amin’izy ireo. Raha mbola tsy misy vahaolana kosa anefa dia tsy maintsy handray fepetra hentitra kokoa izy ireo, raha ny tatitra hatrany. Vokatr’izay dia naneho ny heviny Raharimalala Lydia  Tale Jeneralin’ ity orinasa ity fa “ manaiky izy ireo ny amin’ny handoavana ny karaman’ireo mpiasa tsy voaloa hatramin’ny taona 2015 lasa iny. 

Nanamafy ihany koa ity Tale ity fa tsy vita ao anatin’ny fotoana fohy ny fotoana fandoavana izany noho ny trosa be miangona amin’ny orinasa ankehitriny. Anisany nolazainy aza ny hoe vao roa volana monja ny tenany no tafiditra eo amin’ny fitantanana, ka ny hanarina izany mihitsy no nahatonga azy tamin’io toerana io. Mbola eo am-pamahana olana momba ity  raharaha ity izy  ireo hatreto ary azo lazaina fa mbola mihenjana ny tady satria tsy manaiky intsony ireto mpamboly. Andrasana indray aloha izany ny tohiny zava-misy.

Tatianà R.

Ino Vaovao0 partages

VAROTRA SY FANJIFANA : Hotsaraina ireo mizàna sy ny fitaovam-pandrefesana eto Mahajanga

 Hanomboka amin’ny mizàna sy vatomizàna fandanjana vary, legioma hatramin’ny volamena, ny metatra fandrefesana lamba, ireo famarana ny ranon-javatra toy ny menaka, solotany… Hotsinjaraina isam-pokontany ny fotoana anaovana ny fanamarinana.

Nandritra ny fotoana maro dia tsy nisy io fanamarinana fitaovam-pandrefesana io. Taona vitsivitsy izay dia nisy ny fidinana ifotony nataon’ny tompon’ andraikitra avy ao amin’ny Faritra sy fanjifana eto Mahajanga nahitana fa misy ny hosoka amin’ireny fitaovana ireny, ka  natomboka ny fanaraha-maso azy ireny. 

Mizàna madio miampy karatra manamarina fa mpivarotra ilay olona, ary kara-panondrom-pirenena no entina eny amin’ny sampandraharaham-panjakana misahana ny fandrefesana na ny ‘service de métrologie locale’ any amin’ny biraon’ny sampandraha- rahan’ny fambolena sy fiompiana eny amin’ny ‘bord’. Omena taratasy fankatoavana izay manara-dalàna, fandavana kosa raha mandainga ilay fitaovana. Omena ‘vignette’ izay porofo manamarina fa nahavita ny fanamarinana ny mpivarotra rehefa vita ny fitsarana.

Hisy kosa ny sazy henjana, hoy ny talem-paritra, Belalahy Jean Berchmans ho an’izay tsy tonga mitondra ny mizanany mandritra ny fotoam-pitsarana. Marihina fa araka ny lalàna dia isan-taona no tokony hatao io fitsarana fitaovam-pamarana io.

INVMGA

Ino Vaovao0 partages

ANTANANARIVO : Mpiasan’ny Banky iray manao antsojay amina mpandraharaha maro

Tompon’andraikitra misahana ny lafiny fandoavana trosa eo enivon’izany banky izany ity farany.

Raha toa ka anisany tanjona napetraky ny banky rehetra ny fanohanana ny mpandraharaha dia ohatran’ny tsy izay ny zava-misy ao amin’ny banky voalazan’ireto mpandraharaha ireto. 

«  Miara-miasa amin’ity banky ity izahay an-taonany maro ary ananany trosa izahay, ka aloanay tsikelikely. Iaraha-mahafantatra anefa ny fotoan-tsarotra lalovan’ny Firenena ankehitriny sy ny olana aterak’izay eo amin’ny sehatry ny fandraharahana. Na izany aza miezaka mandoa ny trosan’ity banky ity izahay ary tsy latsaky ny 2/3-n’ny vola tokony haloanay isam-bolana na isan-kerinandro izany. 

Na dia eo ny ezaka vitanay izay mbola tsy mitsahatra manenjika anay isan’andro ny vehivavy tompon’ andraikitra eo amin’ny lafiny «  contentieux  » ity  », hoy ireto farany. «  Tahaka ny mpangalatra fahitan’ity ramatoa ity anay nefa anisany mampidi-bola amin’ity banky ity izahay  », hoy ireo mpandraharaha ireo hatrany. «  Tena marina tsy ny tombontsoan’ilay  banky no tadiavin’ity tompon’andraikitra ity. Ataon’ity farany ny fomba rehetra mba hahazoany vola avy aty aminay fa tsy manaiky an’izany izahay. Raha manam-bola omena azy izahay tsy aleonay handoavana ny trosan’ny banky isam-bolana na isa-kerinandro  ?  », hoy ny fanazavana nomen’iray amin’ireto mpandraharaha ireto. 

Araka ny fahitan’ireto farany azy tsy fantatry ny Foibem-pitondran’io Banky io ny fanenjehana sy fandrahonana mahazo azy ireo isan’andro, ka manao antso avo amin’ny tompon’andraikitra ambony. «  Mba miezaka mandoa trosa izahay, ka tsy tokony henjehina tahaka an’io izahay  », nambaran’ireto mpandraharaha ireto farany.

A.Lepêcheur

Ino Vaovao0 partages

SAROTRA NY FANADINANA BAKALOREA : Misy mitsoaka an-daharana ireo mpiadina

Ny taranja matematika no nampikolay azy ireo ary nisy mihitsy ny nitsoaka an-daharana vokatr’izany.

Raha ny tetsy amin’ny ivon-toeram-panadinana etsy amin’ny lisea Maoderina Ampefiloha dia mpiadina iray tao amin’ny sokajy siantifika no tsy niverina nanohy ny ambin’ny fanadinana intsony rehefa nahavita ny laza adina matematika. Heverina ho diso fanantenana tanteraka izy ary tsy manana faharisihana intsony ny amin’ireo taranja hafa sisa tavela. 

“Taratasy fotsy no nateriny nandritra ny fanatanterahana ny laza adina matematika ary taorian’io tsy niverina namonjy ny efitranom-panadinana intsony izy”, hoy ny fanazavana nomen’ny lehiben’ny ivon-toeram-panadinana etsy amin’ny LMA. 

Ankoatra ireo nitsoaka an-daharana dia betsaka ihany koa no tsy tonga nanatrika ny fanadinana satria nahatratra 78 isa izy ireo teo anivon’ny ivon-toeram-panadinana LMA manokana. Raha oharina tamin’ny taon-dasa dia sarotra avokoa ny laza adina tamin’ireo fanadinam-panjakana tamin’ity taom-pianarana ity. Mampitsitotongavana ny tahan’ireo afaka fanadinana anefa izany, saingy voalazan’ny minisitera tompon’andraikitra fa tanjona ny hamerenana ifotony fari-pahaizan’ny ankizy ary tsy any amin’ny fahabetsahan’ireo afaka fanadinana no hihaza- kazahana.

Avotra Isaorana   

Ino Vaovao0 partages

NOHO NY TAHOTRA : Mihena ny isan’ireo mpandeha taksiborosy mankany atsimo

Mbola mibahan-toerana ao an-tsain’ireo mpandeha ny tahotra manoloana ny fanafihan-jiolahy nifanesy izay nitranga tamin’iny lalam-pirenena iny. Velon-taraina ireo fiara mpitatitra vokatr’izany satria miteraka fatiantoka iray lavaka ho azy ireo izany. Fantatra fa nidina hatramin’ny saran-dalana raha tokony hiakatra izany amin’izao fotoam-pialan-tsasatra izao.

Isan-taona anefa nambaran’ireo mpamily fa ifandrombahan’ireo mpandeha ny taksiborosy ary tsy maharaka mihitsy aza ny famandrihan-toerana, amin’izao fotoana anefa ny mifanohitra tanteraka amin’izany no miseho. Ankoatra ny tsy fandriam-pahalemana dia nilaza ihany koa ny tompon’andraikitra eo anivon’ny kaoperativa fa anisany mampiditra fatiantoka ho an’ny asa fitaterana ny firoboroboan’ny teknolojia amin’izao fotoana izao.

“Maro amin’ny olona no tsy mampiasa taksiborosy intsony fa raha misy ny vola tokony halefa any amin’ny toeran-kafa ohatra dia efa vitan’ireny fandefasam-bola amin’ny alalan’ny finday ireny izany. Raha misy ihany koa ny handefa entana dia manome toky ireo orinasa miandraikitra izany izay sady tonga ara-potoana amin’ilay toerana”, hoy ny voalazan’ireo mpitatitra.

Misedra fahasahiranana tsy toy taloha ireo mpitatitra ary amin’ny fotoanan’ny fialan-tsasatra vao mahita mangirana izy ireo kanefa dia izao sembanan’ny tsy fandriam-pahalemana izao indray.

Avotra Isaorana

Tia Tanindranaza0 partages

FLSH sy DEGS -AnkatsoEfa-bolana tsy nandray vatsim-pianarana

Velon-taraina sy mimenomenona noho ny tsy mbola naharaisan’izy ireo vatsim-pianarana efa ho efa-bolana ny mpianatra ao amin’ny Sampana Haisoratra sy ny DEGS eny amin’ny oniversiten’Antananarivo.

Toky R

 

Tia Tanindranaza0 partages

Hazo avo halan-drivotra !

Tanteraka tokoa ny fomba fiteny hoe ny hazo avo halan-drivotra, ary misongadina izany eo amin’ny tontolo politika, raha dinihina ny fanenjehana ny filoha teo aloha Marc Ravalomanana.

Toky R

 

Tia Tanindranaza0 partages

Lalatiana RavololomananaEfa miteniteny foana sisa

Tsy vaovao amin’ny sofina intsony ny mahita sy mandre mpanao politika be fialonana manenjika ny Antoko Tiako I Madagasikara sy i Marc Ravalomanana.

Toky R

 

Tia Tanindranaza0 partages

Antoko TAMAMIMiandrandra governemanta iraisana

Fotoana izao handraisan’ny filoham-pirenena sy ny rehetra fanapahan-kevitra hentitra hitsinjovana ny hoavin’ny taranaka faramandimby, hoy ny filohan’ny Tamami, Floriot Samihary, nandritry ny antso avo nataony omaly tetsy Anosy.

J. Mirija

Tia Tanindranaza0 partages

AmbohitrimanjakaNodorana ireo rongony 400 kg tratra

Notanterahan’ny polisy misahana ny ady amin’ny fidorohana zava-mahadomelina etsy Anosy omaly, tamin’ny 11 ora maraina teny Ambohitrimanjaka

Pati

Tia Tanindranaza0 partages

Ambohitrantenaina ImerintsiatosikaHanatanteraka didimpoitra faobe ny miaramila

Hanatanteraka didimpoitra faobe ao amin’ny tanànan’Ambohitrantenaina Imerintsiatosika izay misy ny anjara tanin’izy ireo ny miaramila mivondrona ao amin’ny Service civique.

Pati

Tia Tanindranaza0 partages

Androhibe AnalamahitsyNidoboka am-ponja ilay nangalatra tao amin-dry Mompera

Nalefa eny am-ponja vonjimaika omaly rehefa avy nalaina am-bavany ilay lehilahy iray 42 taona voasambotry ny polisy avy ao amin’ny Boriborintany fahavalo etsy Analamahitsy ny fiandohan’ny herinandro teo.

 

 Ireo polisy manao fisafoana no nahatratra azy io  tao an-tokotanin-dry Mompera ao Androhibe Analamahitsy ka mbola tratra teny aminy ny zavoka iray vao avy nangalariny. Niaiky ny heloka vitany ny lehilahy nandritra ny fanadihadiana natao azy. Nilaza ihany koa izy fa efa nigadra noho ny resaka halatra ihany. Marihina moa fa misy namana izy rehefa manao asa famakiana trano saingy tsy mbola nisy tratra ireto farany. Efa marobe ny fitarainana momba azy ireo voarain’ny polisy ao amin’ny Boriborintany fahavalo.

Pati

Tia Tanindranaza0 partages

“Vacation” an’ny mpampianatraTsy maintsy haloa, hoy i Paul Rabary

Betsaka ireo mpampianatra mitaraina ny amin’ny tsy mbola naharaisan’izy ireo ny “vacation” ny hatreto.

 

 Lohalaharana amin’izany ireo mpampianatra nandray anjara tamin’ny fitsarana ny fanadinana BEPC farany teo izay efa tsy nahazo nanomboka tamin’ny taona 2015. Nambaran’ny minisitry ny fanabeazam-pirenena Paul Rabary fa tsy maintsy aloan’ny fanjakana ireny vola ireny na rahoviana na rahoviana fa tsy very akory. Tsy maintsy ny famoaham-bola tahaka ireny no tapaka avy hatrany  rehefa tsy ampy ny eo anivon’ny kitapom-bolam-panjakana, hoy izy. Miankina amin’ny “loi de finances rectificatives” ( LFR) ihany koa ka rehefa miakatra itsy voalohany dia misosa ho azy ny fandoavana azy. Rehefa midina kosa ny LFR dia miantona kely ny fandoavam-bola, tranga izay hiainantsika amin’izao fotoana izao. Na izany aza anefa dia manome toky ny tenany fa tsy maintsy haloa ireny vola ireny. Nampahatsiahiviny manokana fa tsy maintsy mandalo eny anivon’ny DREN sy ny CISCO ny taratasy hahafahana mandray ny vola vao tonga eny am-pelatanan’ireo mpampianatra.

Pati

Tia Tanindranaza0 partages

Fisaonam-pirenenaNiteraka adihevitra goavana

Miteraka resabe eny anivon’ny fiarahamonina ny resaka fisaonam-pirenena nialoha sy taorian’ny nanokanana omaly alakamisy 27 jolay ho andro maloka ho an’ny firenena Malagasy

 noho ny nahalasan’i Régis Gizavo, ilay kintan’ny fitendrena angorodao fanta-daza hatrany ivelan’i Madagasikara. Samy manaiky ny rehetra fa nitondra avo ny voninahi-pirenena izy ary sokajiana ho vakoka maneran-tany mihitsy ny zavatra nataony, ka very olo-manga i Madagasikara sy izao tontolo izao noho ny fahalasanany. Lojika, araka izany, ny fanomezam-boninahitra azy tamin’ny alalan’ny andro fisaonam-pirenena. Mitodika any amin’ny fitondram-panjakana ny fanontaniana hoe inona no mason-tsivana hanaovana fisaonam-pirenena ho an’ny olona iray ? Maninona no tsy nisy ny fisaonam-pirenena tamin’ny fahafatesan’olona 47 tany Anjozorobe ? Sa ireny no atao hoe fatina Malagasy mahantra ka tsy mendrika ny hanaovana izany ? Maromaro ihany ireo mpanakanto fanta-daza teto an-tanindrazana hatrany ivelany toa an’i Om-Gui, Jean Emilien, Rasoakininike, Raul sy Nônô tao amin’ny tarika Mahaleo no efa lasa fa tsy nisy ny fisaonam-pirenena. Mamoha fota-mandry fa misy zavatra tokony hohazavaina sy hampahalalana ny olom-pirenena ny antony mba hialana amin’ny fifanomezan-tsiny sy adihevitra tsy manam-pahataperana sy mety hiteraka ady mihitsy aza. Mila faritana sy ampahafantarina manomboka izao ny mason-tsivana mikasika ny fanomezana mari-boninahitra sy ny fisaonam-pirenena manoloana ny fahalasanana mpanakanto na olo-malaza na mpanao politika iray. Mbola olana ihany koa ny tsy firaharahaina olona ireny sy ny zava-bitany eo am-pahavelomana, fa rehefa maty vao ramalala, ka tsy atao mahagaga, raha misy ny efa milaza sy manafatra dieny mbola velona fa tsy mila salorana izany mari-boninahitra izany. Maro ny zavatra tokony hovaina !

 

Toky R

 

La Vérité0 partages

Echec cuisant

Il n’est plus besoin de ressasser l’état très critique de la situation sécuritaire à Madagascar. Si auparavant, quelques Régions seulement avaient eu la triste réputation des attaques récurrentes des bandits, les « dahalo », le fléau touche en ce temps-ci toute l’étendue du territoire national. Aucune région de la Grande île ne peut narguer en être à l’abri. De jour comme de nuit, les malfrats sévissent, apparemment, en toute quiétude et impunité. 

Le constat, sans complaisance, met en évidence l’échec sur tous les plans des responsables à qui la défense et la sécurité nationale sont confiées, au premier plan desquels figurent les Officiers supérieurs et Généraux de l’Armée, de la Gendarmerie et de la Police. Ils ne peuvent, en aucun cas, se disculper de cette débâcle. Bien entendu, la responsabilité du régime qui n’a pas su édifier, clairement, une politique générale de l’Etat à suivre n’est pas du tout à écarter.  Etant dit la complexité du concept de la sécurité et de la défense ainsi que les gros et sophistiqués moyens exigés, le Système des Nations unies - entre autres le Fonds pour la consolidation de la paix - veut bien apporter son concours, en amont et en aval, à l’élaboration du projet d’Appui à la réforme du secteur de la sécurité à Madagascar (Arssam). Mais, quelle que soit l’assistance des partenaires étrangers, l’efficacité de la démarche dépend essentiellement de l’état d’exécution et de la pertinence des opérations sur terrain. Le moment n’est-il pas venu d’établir une nouvelle orientation générale de l’Armée et de ses composantes. Une autre philosophie de la défense et de la sécurité s’impose dans la mesure où Madagascar, étant une île, ne s’expose pas à des conflits de type frontalier ou à des risques de confrontation armée avec d’autres Etats. En réalité, le danger vient de l’intérieur. L’ennemi de nos Forces de la défense et de la sécurité (Fds) ne serait pas d’origine externe mais, bel et bien, à l’intérieur du pays. Et si l’on évoque l’échec retentissant des Fds, c’est justement, dans leur incapacité totale de maîtriser la recrudescence des attaques à main armée dans tout le territoire et leur impuissance d’éradiquer le phénomène « dahalo » dans le Grand sud, de même que dans les autres Régions qualifiées de « zones rouges ». Toutes les tentatives pour venir à bout du péril lié à l’insécurité étaient, tour à tour, vouées à l’échec. La dernière en date, l’« Unité spéciale anti-dahalo » (Usad), mise en orbite en juin 2016, n’a pas donné jusqu’ici des résultats convaincants. Les tenants du pouvoir doivent mettre à profit, au maximum, la ferme volonté des Organismes onusiens de s’impliquer en profondeur dans ce combat difficile et compliqué contre l’insécurité dans le pays. Les observateurs se désolent de la tergiversation des dirigeants du régime, en place, à prendre le taureau par les cornes. Les trois années et demie, à la tête de l’Etat, n’ont pas suffi à eux de faire leurs preuves. Tout au moins, un grand et sérieux chantier aurait été entamé et aurait dû déjà porter ses fruits. Les analystes avertis doutent de la compétence des dirigeants politiques et des titulaires des postes de commandement des Forces de la défense et de la sécurité du pays à relever le défi.  L’échec cuisant se profile déjà à l’horizon. Qui vivra, verra !Ndrianaivo

La Vérité0 partages

Investissement à Madagascar - L’acquisition des terrains, encore délicate pour le secteur minier

L’Organisme « Economic Development Board of Madagascar » (Edbm) a présenté, hier, à son siège à Antaninarenina le rapport de ses activités durant le premier semestre de l’année 2017. « L’acquisition des terrains  figure parmi les freins encore contraignants dans l’investissement, surtout dans le secteur minier », selon le directeur général de l’Edbm, Eric Robson Andriamihajamananirina. En effet, si une zone économique spéciale (Zes) a été mise en place pour le secteur textile - c’est-à-dire des sites stratégiques pour favoriser l’extension de ses activités mais aussi pour attirer de nouveaux investisseurs -  et cela après vérification des propriétaires, « des difficultés se font encore sentir surtout que toutes les propriétés n’ont pas encore été toutes déclarées », a-t-il ajouté.

Par conséquent, la situation est d’autant plus délicate pour le secteur minier où les mines à exploiter se retrouvent sous des terrains qui appartiennent à autrui, surtout dans la mesure où les entreprises n’ont de droits que sur la mine. « Dans des situations de ce genre, il n’y a pas de vraies solutions, mise à part la vérification ». Des problèmes qui freinent encore l’exploitation du meilleur potentiel du secteur en question.1 400 nouvelles entreprises recencéesUn rapport estimé très prometteur pour le secteur de l’investissement à Madagascar. Pour cette première moitié de l’année, l’Edbm a recensé plus de 1 400 nouvelles entreprises investies dans l’économie malgache dont 53 % sont des investisseurs nationaux. Pour les 47 % restants, les investisseurs se répartissent entre l’Asie qui regroupe plus de 150 nouvelles sociétés, suivie de l’Europe qui en compte  85, une trentaine pour l’Afrique sub-saharienne  et les Etats-Unis qui closent le classement avec une douzaine de nouveaux implants dans le pays. Toutefois, la Chine est toujours en tête de la liste des pays investisseurs et c’est la France qui vient en seconde position. Ces nouveaux investissements se sont surtout focalisés dans le secteur du textile, celui de l’agriculture ainsi que les mines, et plus particulièrement dans les technologies de la communication et de l’information qui ont connu une croissance de 180 % ces 3 dernières années. En tant qu’Agent de promotion des invetissements (Api) à Madagascar, l’Edbm a ajouté dans son rapport qu’il travaille en ce moment dans la promotion de Madagascar à travers les « roadshows » organisés partout dans le monde. Les prochaines destinations sont l’Italie, Londres (Royaume-Uni) ainsi que le Canada.Rova R.

La Vérité0 partages

Noely Sakelidalana - « Malgré mes problèmes oculaires, je ne cesserais jamais de chanter »

Derrière ce « petit homme », mettant d’ardeur dans son travail et beaucoup de sérieux dans la musique, se cache un personnage généreux, souriant et drôle dans la vie quotidienne. Lui c’est Robiaritovo Tyd Noël, connu par ses fans par Noely Kely dans le groupe Sakelidalana. On reconnaît sa voix parmi des milliers. Cette personne ayant une tonalité simple comme celle d’un enfant, mais ornée d’une sagesse et d’une innocence inouïes, arrive à chanter une note très haute que seules les filles pourront exercer. Bref, Noely est unique en son genre. Cela fait maintenant cinquante-deux ans qu’il est derrière son micro, mais il est toujours impeccable, toujours cet artiste qui peut reprendre à sa manière tous les rythmes de chansons qu’on veut. Noely a actuellement plus de 60 ans et pourtant, il n’a jamais pris la retraite. Et ce, malgré son problème oculaire qu’il porte maintenant depuis 9 ans. Une difficulté qu’il assume et qui ne lui pose aucune gêne car il continue de vivre son quotidien normalement, à part son travail de couturier professionnel qu’il ne peut malheureusement plus exercer. Auteur et compositeur, Noely fait partie des artistes locomotives du Ba-gasy depuis les années 80 jusqu’à maintenant. Participant à l’édition 2017 de Tana in Love qui se déroulera demain au Palais des sports Mahamasina, il nous accordé une petite interview !

La Vérité : Pourriez-vous nous raconter votre début dans la musique ?Noely : L’aventure a commencé en 1965. On n’était encore que des gamins et je me souviens bien de cette époque car je n’avais que 13 ans. On aimait chanter entre camarades, après les parties de foot dans les rizières juste à côté du village. On se donnait rendez-vous pour chanter du Vaky Sôva en groupe. C’était une habitude et l’on ne se séparait que très tard. Etant donné que la famille Rakotozanany Stanislas était locataire de la maison familiale de ma grand-mère, on se côtoyait souvent et il a apprécié ma voix. Il a détecté mon talent et puis il m’a proposé de chanter avec son groupe portant son nom. La formation a été créée en 1963 et je l’ai intégrée en 1965. A l’époque, on ne faisait que du Vaky Sôva et parfois du Vakodrazana et on aimait ça. On a voulu professionnaliser ce que l’on faisait et ça semblait marcher car le groupe Rakotozanany Stanislas était une des formations les plus connues de l’époque. Je me souviens de ma première apparition sur une grande scène. C’était à Antsahamanitra durant un événement « Bemiray » organisé par Ny Railovy. Le public nous a appréciés et cela nous a motivés pour continuer de l’avant dans la musique.La Vérité : Vous avez ensuite rejoint le groupe Sakelidalana.Noely : Effectivement, je suis plus connu par le grand public en tant que membre du groupe Sakelidalana. Ce dernier est en fait composé des derniers membres de mon ancienne formation, Rakotozanany Stanislas. Puisque son fondateur, un journaliste, ne pouvait plus continuer la musique à cause de sa vie professionnelle, il a dû quitter le groupe en 1979. Les autres membres dont moi ont par contre continué la musique. Je me souviens bien de ce moment car notre dernière chanson sortie était« Voahangy ». Nous avons donc décidé de poursuivre notre bonhomme de chemin et mettant sur pied le groupe Sakelidalana en 1980. On a choisi ce nom par hasard car à l’époque beaucoup nous appelaient sans raison Sakelidalana.  On a pris la décision de nommer la formation ainsi car c’est un nom plus proche de la bouche du public. Nous avons ensuite repris le morceau « Voahangy » et c’était un grand succès auprès du public. Je pourrais dire que c’est seulement le nom qui a changé mais le feeling et l’ambiance sont restés les mêmes. C’est aussi à ce moment qu’on a décidé de se consacrer plus au Ba-gasy, un rythme choisi par amour de la culture malgache mais surtout pour sa musicalité. Nous avons ensuite sorti plusieurs titres et des clips et des albums.La Vérité : Combien d’albums avez-vous réussi à sortir ?Noely : En réalité, nous nous sommes plus consacrés à la création mais pas trop sur l’enregistrement en studio. Nous comptons plusieurs chansons, étant donné que la plupart des membres sont auteurs. Mais nous ne les avons pas encore publiées, dans les médias. De plus à l’époque, il n’y avait pas encore d’Internet. Au total, nous avons réussi à sortir 3 albums dont le premier s’intitulant« Voahangy »  est sorti en 1998. En 2000, le groupe a sorti le volume de 2 « Nandalo teto ve », produit par Studio mars. Le dernier album en format Cd est « Sakelidalana chante Rakotozanany Stanislas ». Cet opus est une reprise de toutes les anciennes chansons du groupe avec d’autres touches musicales. Les morceaux ont été réenregistrés en studio, réarrangés. Par ailleurs, nous avons déjà aussi sorti plusieurs disques 45 tours bien avant les Cd, c’est-à-dire en 1982, comme « Azafady ry sakelidalana », « Fitia manalasala », « Zovy », « Vazon-dravalovotaka », ou encore « Vetso sara-dray ».  La Vérité : Concernant les tournées…Noely : Jusqu’à maintenant, nous avons réussi à effectuer plusieurs tournées dans la Grande île et aussi à l’étranger. Notre première sortie du territoire malgache était en 1988. C’était en France, lors du premier festival de la Francophonie. Cette grande première a marqué ma vie et j’en remercie Dieu de m’avoir donné cette chance de pouvoir partir à l’étranger car sans la musique et le talent qu’il m’a donné, je n’aurais jamais réussi. Cela fait maintenant 3 fois qu’on a effectué des voyages à l’étranger, en France mais aussi en Suisse.  La Vérité : Quels sont les thèmes que vous évoquez souvent dans vos chansons ?Noely : Comme je l’ai dit, Rakotozanany Stanislas était un grand journaliste et puisqu’il était un grand patriote, on parlait souvent du « Maha-Malagasy » dans nos chansons. Nos œuvres étaient plus ou moins revendicatives. Il a voulu que la formation soit une vitrine de la morale, la culture et la musique malgache et jusqu’à maintenant, cela ne change pas même si on parle d’autres thèmes notamment l’amour dans nos chansons. Puisque la vie était dure, à l’époque, et que les artistes menaient leur part de responsabilité afin de dénoncer les injustices à travers leurs œuvres, les Sakelidalana se consacraient aussi à cette lutte. Nous nous sommes inspirés de la réalité sociale et politique que nous extériorisons à travers nos morceaux. La Vérité : Vous avez une voix et un timbre vocal hors du commun. Pourriez-vous nous révéler le secret de son entretien ?Noely : Effectivement, j’ai cette voix un peut aigüe qui ressemble à un jeune homme n’ayant pas encore atteint son adolescence. Beaucoup même me taquinent avec ma voix. Tout d’abord, je remercie encore le grand Dieu de me donner encore la force de pouvoir chanter comme je le fais car à mon âge, il serait bien difficile de chantonner ainsi. En fait, il n’y a pas vraiment de secret mais j’entretiens depuis toujours ma voix. Je ne bois jamais d’alcool et je ne fume pas. Aucune goutte d’alcool ni aucun joint n’ont touchés ma langue et ma bouche depuis toujours jusqu’à maintenant. J’ai toujours évité les aliments excitants comme le poivre, le piment ou encore le gingembre. J’adore aussi chanter et chaque fois que je n’ai rien à faire, je me mets au chant. Ce qui me permet de maintenir ma qualité vocale. La Vérité : Les collaborations artistiques ?Noely : Depuis toujours jusqu’à maintenant, je n’ai jamais eu de problème avec les autres. groupes. Que ce soit l’ancienne ou la nouvelle génération d’artistes, je suis toujours ouvert à toute collaboration artistique. J’ai par exemple déjà chanté avec Volatiana, Bodo, Abel Ratsimba et bien d’autres encore. Et pour ce Tana in Love, je chanterai encore avec plusieurs jeunes artistes et je trouve cela merveilleux. La Vérité : Votre problème oculaire pose-t-il un problème sur votre carrière musicaleNoely : Jamais ! Cela fait maintenant 9 ans que je suis complètement aveugle mais je continue toujours de chanter. Au contraire, ça ne me pose aucun problème car je peux toujours faire ma musique avec ou sans mes yeux. Dieu l’a voulu ainsi et je le remercie toujours car il juge que c’est bien pour moi. Je voudrais même dire ce mot pour les lecteurs :« Na sompatra aza ny natiora, manao izay analam-baraka, Noely dia mbola mihira, raha tsy Jehovah no maka ! ». Tout simplement pour dire que tant que je suis en vie, et que j’aurai de la force, je continuerai toujours de donner le meilleur de moi-même dans la musique. Jusqu’à maintenant, j’écris toujours des chansons et mon fils m’aide beaucoup dans la réalisation. Il enregistre sur un dictaphone ma voix et les paroles sur son bloc note et on le travaille ensemble jusqu’en studio. Dès fois, je mets deux jours à écrire une chanson et parfois ça dépasse le un mois. Néanmoins, je ne peux plus exercer mon métier de couturier. On va dire que j’ai pris ma retraite (rire) et quand je ne suis pas en tournée ou en studio, je passe mon temps à écouter la radio Vaovao Mahasoa (Rvm). La Vérité : Le Ba-gasy a-t-il toujours sa place dans le monde du showbiz ?Noely : Bien sûr que oui. Même si on n’entend pas souvent ce genre de musique à la radio, le Ba-gasy occupe toujours une grande place dans le monde du showbiz national. Pour preuve, d’autres grandes formations sont toujours très célèbres malgré l’existence d’autres rythmes qui attirent plus les producteurs. D’ailleurs, en ce moment, les gens veulent plus de musique qui font bouger. C’est donc normal que les organisateurs événementiels se tournent tous vers eux et pas vers nous. Cependant, nous effectuons toujours des tournées dans la Capitale ou dans les régions sans faire des grandes publicités médiatiques. La Vérité : Votre point de vue sur la musique actuelleNoely : La musique malgache a été et est toujours meilleure. Chaque région dispose de son style et genre musical et cette richesse culturelle fait de nous un pays de l’inspiration et du talent. Ces genres sont tous appelés du Ba-gasy car ça reflète la culture malgache. Le seul inconvénient, les paroles de chansons. Par manque de qualité et d’inspiration ou tout simplement de culture générale, on n’utilise plus la musique pour éduquer mais pour amuser. Je me souviens de l’époque où régnait la censure.  On ne pouvait même pas dire « chien » dans nos paroles. De 1963 jusqu’à 1972, tous les auteurs devaient présenter leurs œuvres à la commission d’écoute du gouvernement avant de les diffuser sur les ondes. On passait même des auditions auprès de ce comité pour vérifier l’arrangement, la qualité de la musique et surtout les textes.La Vérité : Quel genre de père êtes-vous?Noely : Je suis le genre de père qui ne veut que du bonheur pour sa famille. Je suis strict et parfois sévère surtout quand il s’agit de l’éducation de mes petits-enfants. Je suis marié à une seule femme et j’ai un seul garçon qui se consacre actuellement à la musique avec moi. Il est aussi membre de mon propre groupe faisant de l’évangélique mais aussi du Sakelidalana. Je suis le grand-père de deux petits anges : Aina et Tita. J’aime beaucoup mes petits enfants et j’espère qu’ils se mettront aussi à chanter comme leur père.  La Vérité : Tana in Love 2017…Noely : C’est un grand plaisir et un honneur pour moi que l’organisateur réserve une partie pour moi dans ce grand concert. J’ai depuis le début participer à ce concept Tana in Love et à ce comeback, je suis toujours à l’affiche et je suis fier de partager de nouveau la scène avec mes amis artistes. Le show va être exceptionnel et je promets de me donner à fond pour le spectacle. Une occasion pour les fans de me voir dans la peau d’autres chanteurs.

La Vérité0 partages

Loi de Finances 2018 - La société civile exige plus de transparence

Hier, à l'hôtel Le Pavé Antaninarenina, la rencontre entre le ministère des Finances et du budget, les institutions, les ministères sectoriels, et les organisations de la société civile, dans le processus d'élaboration de la loi de finances 2018, a été l'occasion pour ces dernières d'évoquer les différentes incohérences entre les données théoriques sur les budgets annoncés et leurs répartitions et utilisations effectives. Parmi les intervenants lors de la séance de collecte d'idées, Félix Rabekijana, représentant le KMF Cnoe, a particulièrement soulevé les problèmes du défaut d'indépendance des organes responsables du bon déroulement des élections.

Par ailleurs, en termes de répartition et d'octroi des budgets, il a suscité le doute concernant la correspondance entre le montant indiqué sur le document écrit, et celui qui parviendra réellement aux destinataires. « D'après les indices, tout laisse à croire que ce n'est pas le cas, puisque jusqu'à maintenant, rien ne semble indiquer les impacts positifs de ces moyens pécuniaires sur l'existence des petites gens qui normalement devraient être les véritables bénéficiaires », a-t-il confié. Pour pallier ces inconvénients, il faudrait un suivi rigoureux par les responsables de l'Etat. Et de poursuivre : « En matière de sécurité, il n'est pas rare d'entendre dire qu'en cas d'intervention pour des forfaits, les victimes  prennent en charge le carburant, voire le véhicule qui va servir pour le déplacement des responsables de la sécurité publique ». Un manque de transparence flagrantOny Radert, également de la société civile, a tenu à renforcer la demande de transparence dans la présentation de la loi de finances. Aujourd'hui, le ministère des finances publiques a avancé la collaboration avec la société civile dans l'élaboration des lois de Finances 2018. C'est déjà un point positif. Cependant, jusqu'à maintenant, nous n'avons pas constaté cette transparence au niveau des subventions. Par exemple, pour les maîtres Fram, nous n'avons pas les moyens de faire un suivi de leurs subventions. Il en est de même concernant les carburants, alors qu'on sait qu'il y a du gaspillage au niveau du poste budgétaire relatif à ce volet. Par rapport aux allocations budgétaires, la population attend des résultats, et il faut que les institutions et les ministères nous fassent savoir quels sont les résultats effectifs que nous citoyens sommes en droit d'attendre. Concernant les indicateurs de performance, elle a annoncé que certains ne sont pas adéquats. En exemple, elle a cité le cas du ministère de la Santé qui a affiché plus d'un indicateur « 0 » pour l'année 2017. En sus, Ony Radert  a suggéré la répartition des médecins étant donné que de nombreuses régions en sont dépourvues. Et d'ajouter : « Pour les organes de contrôle, ils n'ont pas les moyens et le matériel adéquats pour mener à bien leurs missions, et ne disposent pas d'une indépendance légale pour pouvoir agir ». Il va sans dire que cette multitude de remises en question mentionnées par les représentants de la société civile, concernant  différents secteurs, constitueront de vrais casse-tête aux responsables des institutions étatiques et des ministères qui devront trouver des solutions pour prouver leur bonne et réelle volonté à mettre en pratique les théories de la politique nationale de développement.Rivo S.

La Vérité0 partages

Rugby – Ligue Analamanga - Le Malagasy Rugby retire toutes les licences des clubs

Coup de tonnerre. « La Fédération Malagasy de rugby a retiré toutes les  licences distribuées aux dirigeants de clubs qui ont disputé les rencontres organisées par la ligue Analamanga le dimanche 23 juillet dernier. Et la fédération prévient toute tentative d’utiliser encore ces licences ». Telle est la sanction pour ces clubs annoncée par Marcel Rakotomalala, le président du Malagasy Rugby (MR), hier, lors d’un point de presse qui s’est tenu au siège de la Fédération à Ankorondrano.

« Non seulement, le match organisé par l’instance régionale n’a pas eu l’aval de la Fédération, instance suprême qui autorise toutes rencontres de rugby organisées à Madagascar, mais le nom de la fédération n’a pas été mentionné dans l’entête de l’affiche. Autrement dit, la ligue Analamanga vient de résilier son affiliation au sein de la fédération et c’est idem pour tous les clubs qui l’ont rejointe durant ce tournoi », explique le président. Ces clubs ont été déjà avertis par la Fédération dans une lettre, avant le jour du match, de ne pas participer à toutes rencontres organisées par la ligue Analamanga. Il est à noter que cette sanction concerne, le club Uas Cheminot, le 3FB, le Tam Anosibe, le TFA, le Matadore A Anosipatrana, XV Family, TFMA, IRC. La ligue a déjà annoncé que le top20 a été adopté pourtant, aucune lettre officielle qui confirme cela n’est jamais parvenue entre les mains de la fédération. « Le président de la ligue Analamanga a fait semblant d’accepter cette formule pour éviter les sanctions, car il a été convoqué en Conseil de discipline. Nous avons fait tomber une sanction sportive malgré le comportement portant atteinte à la sécurité publique  et désobéissance civile pour avoir interrompu un tournoi autorisé par l’instance nationale le 21 mai au stade Makis qui est d’autant plus un acte criminel. Mais nous avons décidé de laver notre linge sale loin des regards du public », résume le numéro un du rugby.Le ministère de  la Jeunesse et des sports a été avisé de cette sanction mais aucune réaction de la part de celui-ci. Effectivement, le MR a décidé de prendre les mesures par rapport au statut et les droits qui reviennent au comité exécutif. La ligue Analamanga n’a pas de comité exécutif et le Malagasy rugby a constitué un comité Ad hoc pour éviter une saison blanche. Elias Fanomezantsoa

La Vérité0 partages

Projet Ambatovy - Paiement d'une grosse somme en vue

Les pourparlers entre le projet Ambatovy et les responsables communaux entamés jeudi dans la ville de Toamasina (cf. notre publication d'hier) se sont poursuivis au palais de région à Mangarano hier. La teneur des échanges n'est pas accessible. Mais, selon des indiscrétions, il s'agissait de voir les modalités de paiement et de distribution d'un montant de 12 millions de dollars environ pour les communes rurales traversées par les pipelines qui partent des gisements d'Ambatovy, dans la commune suburbaine d'Ambohibary, Moramanga, jusqu'à l'usine de traitement dans la ville du port.

Théoriquement, 60% du fonds vont aux communes concernées, 20% à la région et 20 % à la préfecture, à défaut de la province autonome. L'administration municipale de Toamasina, en entendant parler de la somme, aurait aussi exprimé sa soif d'obtenir sa part. Ceci est un peu ridicule dans la mesure où le tracé des pipelines d'Ambatovy s'arrête en dehors du cadre urbain. Aux dernières nouvelles, le chef de Région Atsinanana, Michel Talata, a dû faire le ménage en remerciant les membres de son cabinet jeudi. Peut-être en vue de la gestion saine de la manne en perspective.M.R.

La Vérité0 partages

Mandrosoa-Ivato - L’état des 6 accidentés reste stationnaire

L’opinion est encore marquée par le carambolage ayant impliqué 4 voitures, survenu jeudi vers 23h sur la Rn52, précisément près du Paon-d’Or à Mandrosoa-Ivato. Cet accident a fait au moins 6 blessés, jugés assez graves, car les autres ont pu regagner leur foyer respectif. Les victimes qui se trouvaient dans les trois voitures les plus touchées souffrent de traumatisme et de quelques fractures dont la clavicule pour une jeune femme. Elles ont dû être hospitalisées et leur état reste donc stationnaire, selon une source hospitalière.

Rappelons que, la bourde du conducteur d’une Peugeot 3008 grise roulant à tombeau ouvert en provenance d’Ivato, serait à l’origine du drame. Non seulement, il y a eu un excès de vitesse, mais le jeune qui était à son volant, aurait perdu le contrôle de son véhicule en plein virage et après une série de dépassements dangereux. Finalement, la Peugeot a percuté de plein fouet l’Opel Combo et les deux autres voitures qui ont roulé en provenance du centre-ville. « A bord de la Peugeot, des jeunes qui auraient arrosé un peu trop la fin de l’examen du baccalauréat. D’ailleurs, des bouteilles d’alcool largement entamées ont été trouvées dans la voiture », déclare un riverain. Le choc fut tel que l’Opel fut scindé en deux à la suite d’une rupture de châssis. Une autre voiture a failli même prendre feu. « J’ai peur que la voiture allait exploser car il y avait déjà beaucoup de fumées et je m’étais attelé à dégager les passagers des décombres », explique pour sa part le chauffeur d’une des voitures venant d’Ivato.Simultanément au drame, le véhicule tout-terrain d’un particulier a été réquisitionné pour évacuer les blessés vers le centre-ville. Ce n’est pas la première fois qu’un accident s’est produit sur cette route d’Ivato. Des riverains se plaignent qu’il s’y passe des horreurs, jour et nuit. « Ils roulent trop vite alors que la route n’est pas trop sûre. D’où ces successions de drames », explique l’un d’eux. Un autre n’a pas hésité à déclarer que tout le tronçon allant de Talatamaty jusqu’à Mandrosoa, est très dangereux et il a fait déjà beaucoup de victimes, piétons inclus.A noter que les déclarations de la Gendarmerie nationale arguent que les accidents de la route ont fait 90 morts l’année dernière dans la Région d’Analamanga.Franck Roland

La Vérité0 partages

Centre national de transfusion sanguine - Don de sang du personnel du Groupe Sodiat

Le Centre national de transfusion sanguine (Cnts) est souvent en rupture de stock de poche de sang. Chaque jour, il sort environ 80 à 90 poches de sang de son réserve. Dans la plupart des cas, les femmes qui ont perdu beaucoup de sang lors de leur accouchement, les personnes atteintes de cancer ainsi que les malades souffrant de drépanocytose, ont le plus besoin de transfusion sanguine. Les usages du sang collecté lors des dons sont multiples, mais les besoins sont toujours là.

Afin d’apporter son soutient au Cnts, le groupe Sodiat a effectué hier un don de sang dans son siège à Talatamaty. Une cinquantaine de membres du personnel issus de ce groupe ont offert leur sang volontairement. « Donner de sang, c’est sauver des vies. C’est pour cette raison qu’il est important d’effectuer des actions comme celle-ci. Donner du sang permet également de renouveler le sang du donneur. Cela permet aussi d’éviter diverses maladies », a avancé Andro Abela Rakotondratsarahomby, responsable sanitaire auprès du groupe Sodiat. Ce n’est que la première édition. Et prochainement, le groupe envisage d’étendre cette action dans les branches de Sodiat situées dans les autres Provinces. « Donner du sang est important, puisqu’il fait partie intégrante des soins médicaux. Beaucoup de gens sont contraints de le faire. Pourtant, tout le monde peut donner du sang, quatre fois pour les hommes et trois fois pour les femmes », a avancé le docteur Andrianavalojaona, responsable communication au sein du Cnts.Le Cnts est confronté à la nécessité de trouver suffisamment de sang. 20 % des poches utilisées par ce centre sont issues des compensations familiales. Anatra R.

Madagascar Tribune0 partages

Hommage à Zo Rakotoseheno

Un dernier hommage au regretté sénateur Zo Andriambola Rakotoseheno, décédé dimanche, s’est tenu dans les enceintes du Sénat Anosikely le vendredi 27 juillet. Une occasion pour le Président du Sénat Rivo Rakotovao, représentant le président de la République de lui décerner, à titre posthume, le grade de Grand Officier de l’Ordre National. La cérémonie s’est déroulée en présence des représentants de la Présidence de la République, des membres du Gouvernement, du Président de la Confédération africaine de Football, Ahmad ainsi que la grande famille du Sénat.

Ancien journaliste, le sénateur était parmi ceux qui défendaient le code de la communication actuellement en vigueur. Il aurait proposé la responsabilisation des directeurs de publications qui devraient être actionnaires majoritaires des médias concernés. Cette disposition évite à de simples employés de se retrouver premiers responsables pénalement parlant des médias alors que dans la majorité des cas, pour de nombreux médias, les instructions viennent « d’en haut ».

Madagascar Tribune0 partages

Hery Rajaonarimampianina candidat ?

Pour l’heure, nul ne sait qui sera le candidat du HVM pour l’élection présidentielle malgré une forte sollicitation du président de la République de la part de ses membres. En effet, hier au Carlton, les ténors du HVM ont une fois de plus appelé Hery Rajaonarimampianina à se présenter à sa propre succession. Ce dernier devra se prononcer dans les semaines à venir d’autant plus que le dépôt de dossiers est prévu pour le mois d’aout.

La Constitution exige la démission de Hery Rajaonarimampianina de son poste au plus tard le 7 septembre s’il décide de se présenter à la prochaine élection. Dans son article 46, alinéa 2 cette loi fondamentale de République indique que « le Président de la République en exercice qui se porte candidat à l’élection présidentielle démissionne de son poste soixante jours avant la date du scrutin Présidentiel. Dans ce cas, le président du Sénat exerce les attributions présidentielles courantes jusqu’à l’investiture du nouveau Président ».

Cette hypothèse peut expliquer la démission de Rivo Rakotovao, car une fois devenu président de la République, il ne pourra plus assurer la présidence du parti présidentiel comme l’article 49 de cette même Constitution l’indique : « Les fonctions de président de la République sont incompatibles avec toute fonction publique élective, toute autre activité professionnelle, toute activité au sein d’un parti politique, d’un groupement politique, ou d’une association, et de l’exercice de responsabilité au sein d’une institution religieuse ».

Mais avec le départ des autres piliers du parti ces derniers temps, qui prépareraient aussi actuellement leur candidature à la prochaine présidentielle, c’est le cas entre autres d’Olivier Mahafaly Solonandrasana ou encore de Narson Rafidimanana, il est incontestable que le HVM perd petit à petit ses forces et puissances, d’autant plus que les dirigeants actuels n’ont jamais obtenu une cote de popularité assez importante auprès de la population, le président Hery Rajaonarimampianina pourrait renoncer de se présenter à la présidentielle.

La logique politique veut en qu’il soit le candidat naturel de son parti à la course à la magistrature suprême, mais l’insistance des membres de son parti, comme c’était le cas hier au Carlton à Anosy, laisse croire qu’ils essaient de convaincre le président de la République de se présenter parce qu’il ne serait pas motivé pour le faire d’où le sacrifice du Rivo Rakotovao qui accepte enfin de démissionner de la présidence du HVM pour restructurer ce parti présidentiel afin qu’il soit puissant pour mieux soutenir la candidature de Hery Rajaonarimampianina.

Madagascar Tribune0 partages

Le parti présidentiel en déliquescence ? : Rivo Rakotovao démissionne de la présidence du HVM

Incontestablement, le vent de changement soufflé par les 73 députés de l’opposition sur la place du 13 mai a ébranlé le parti présidentiel. Depuis la chute du gouvernement d’Olivier Solonandrasana Mahafaly, le Hery Vaovao ho an’i Madagasikara (HVM) traverse une très mauvaise passe, pour ne pas dire qu’il est en déliquescence. Des anciens ministres qui préparent leurs propres chemins et qui s’apprêteraient à participer à la course à la magistrature suprême contre éventuellement leur ancien patron qu’est l’actuel président de la République, d’autres qui dévoilent les secrets du parti, à l’instar de l’ancien ministre de l’Education nationale, Paul Rabary. Pas plus tard qu’hier, c’est le président national du parti, Hery Rakotovao qui a présenté sa démission.

Rivo Rakotovao, ancien ministre d’Etat chargé des infrastructures, de l’équipement et de l’aménagement du territoire, autrefois numéro 2 du premier gouvernement du régime Rajaonarimampiainaina, a expliqué qu’à cause d’une restructuration du parti, il doit démissionner de la présidence du HVM. Une démission loin d’être fortuite, car au vu de la situation politique actuelle, elle ne peut être motivée que par deux choses : son éventuelle accession à la présidence de la République, car la Constitution le fait président de la République par intérim si l’actuel président venait à démissionner, parce qu’il se présentera à la course à sa propre succession à la magistrature suprême et les déboires du parti actuellement dans lesquels Rivo Rakotovao ne peut se dédouaner de toute responsabilité.

Le passé récent du régime HVM nous rappellera la guéguerre politique entre les ténors du parti, notamment entre le président du Sénat, en la personne de Rivo Rakotovao et l’ancien Premier ministre, Olivier Solonandrasana Mahafaly. Mais cela est devenu actuellement une véritable scission qui aurait entraîné le mis à l’écart de cet ancien Premier ministre du régime, mais aussi d’autres personnalités comme Paul Rabary qui, avant d’être nommé ministre était, rappelons-le, conseiller spécial de Hery Rajaonarimampianina. Si cet ancien ministre s’est mis à critiquer le parti, ce serait en grande partie à cause de propos que le désormais ancien président du HVM auraient tenu.

Une restructuration, pour reprendre le terme utilisé par Rivo Rakotovao, ne peut qu’être utile et nécessaire actuellement pour le parti présidentiel s’il se veut à la hauteur de son ambition de vouloir briguer un autre mandat et que son candidat fasse partie des favoris et franchira le premier tour de la présidentielle du 7 novembre prochain. Hery Rajaonarimampianina l’aurait déjà compris en disant quelques semaines plus tôt, lors de son « Mada Raid », qu’il a actuellement besoin de « sangs neufs » qui pourront effectivement le propulser encore plus loin, plus loin que possible, pour qu’il puisse réaliser ses objectifs lointain, le « Fisandratana 2030 ».

Quoi qu’il en soit, la situation actuelle du HVM rappelle bien la triste histoire du parti socialiste en France à la veille justement de l’élection présidentielle de 2017. Le scénario est presque similaire à quelques détails près, sauf que pour les Malgaches, il s’agit d’une lutte de pouvoirs due à la pauvreté économique et sociale, mais pour les Français dont le pays est économiquement et socialement déjà développé, il s’agissait d’une lutte contre une autre forme de pauvreté…

Madagascar Tribune0 partages

Plus de 830 infractions et 400 déferrements en moins d’un mois

Avec plus de 400 déferrements en moins d’un mois dans la capitale, la police nationale malgache a certainement enregistré une performance record en matière de sécurité. D’autant plus qu’on apprend qu’ils ont enregistré plus de 830 infractions dues principalement au vol, à la consommation de drogue, depuis le début du mois. Malheureusement, il n’y a rien de réjouissant dans cette situation, parce que cela témoigne l’importance, voire la dangerosité de l’insécurité en milieu urbain. Même les forces de l’ordre semblent être débordées par la situation.

Dans le détail, l’information rendue publique par les forces de l’ordre indique que près de 50 personnes mises en cause dans le cadre de ces infractions ont été arrêtées par détention ou consommation de drogue. Les policiers ont été saisis des armes de tous genres, mais notamment des pistolets automatiques avec leurs balles. Ils ont également interpellés une cinquantaine de charlatans qui attirent les gens à des jeux prohibés en lieu public.

La police nationale a indiqué qu’elle va poursuivre les opérations de renforcement de la sécurité, notamment en milieu urbain, afin d’instaurer un réel climat d’apaisement et de sécurité dans le pays, à la veille notamment de l’élection présidentielle.

Madagascar Tribune0 partages

91 décès enregistrés en deux mois

Les décès liés au coronavirus s’accroissent de jour en jour. En 2 mois et 9 jours, Madagascar a enregistré 91 décès liés à la Covid-19. Hier, 6 nouveaux décès ont été recensés, dont 3 à Analamanga, 3 autres dans la région Boeny.

D’autre part, 395 nouveaux cas positifs ont été recensés dimanche dernier, selon le dernier rapport du CCO-Covid-19. Le nombre total de contaminations dans toute la Grande Ile est désormais de 9 690 cas.

 Nouveaux cas de contamination : 395

306 cas sur 666 tests PCR réalisés 89 cas sur 220 tests GeneXpert Analamanga : 269 cas positifs Alaotra-Mangoro : 52 Bongolava : 29 Boeny : 10 Diana : 9 Anosy : 6 Sava : 5 Itasy : 3 Analanjirofo : 3 (tous à Mananara Avaratra) Atsimo Atsinanana : 3 (tous à Vangaindrano) Sofia : 2 Ihorombe : 1 Localisation des 3 derniers cas : non communiquée

 Nouveaux cas de guérison : 243

196 guéris en traitement à domicile à Analamanga 47 guéris dans les hôpitaux ou autres centres de traitement, dont : CHU de Befelatanana : 12 CHU d’Anosiala : 8 Fenoarivo : 4 CNAPS de Vontovorona : 2 CTC Ivato : 1 Analanjirofo : 8 Antsirabe : 4 CHU d’Andrianjato Fianarantsoa : 3 Bongolava : 3 CHU Toliara : 1 Vatovavy Fitovinany : 1

 Malades souffrant de la forme grave : 88

CHU de Befelatanana : 49 HJRA : 17 Anosiala : 5 Andohatapenaka : 2 HOMI de Soavinandriana : 1 Fenoarivo : 3 Antsirabe : 5 CHU d’Andrainjato Fianarantsoa : 3 Boeny : 2 Toliara : 1

 Dernier bilan :

Confirmés : 9 690 Guéris : 6 260 Malades sous traitement : 3 339 Formes graves : 88 Décès : 91

 Tests PCR effectués : 38 587 (entre le 19 mars et le 26 juillet)

Madagascar Tribune0 partages

Le projet Ambatovy demande à reprendre ses activités

Sumitomo Corporation, premier actionnaire au sein du projet Ambatovy, cherche à reprendre ses activités aussi tôt que possible. Ses activités de production du nickel et du cobalt ont été temporairement suspendues depuis plusieurs mois. A cause de la propagation du coronavirus dans la ville de Toamasina, des centaines d’employés étrangers ont dû être rapatriés dans leur pays d’origine et les salariés mis au chômage technique.

Ces derniers jours, la compagnie, avec l’appui de l’ambassade du Japon à Madagascar, multiplie les actions et les lobbys auprès de l’Etat malgache pour pouvoir reprendre ses activités. Deux semaines plus tôt, le 13 juillet dernier, l’ambassadeur du Japon, Yoshihiro Higuchi s’est entretenu en visioconférence avec le ministre des Mines et des ressources stratégiques, Fidiniavo Ravokatra à ce propos.

Le projet Ambatovy est le plus grand investissement du Japon à Madagascar et joue un rôle important dans le développement économique et social à Madagascar, avance l’ambassadeur japonais. Il sollicite ainsi l’assistance du gouvernement malgache afin que la production puisse être reprise dans le plus bref délai et dans les meilleures conditions.

En attendant cette reprise très attendue des activités d’Ambatovy, Sumitomo Corporation se montre généreuse envers l’Etat malgache et continue d’appuyer les efforts du gouvernement dans le cadre de la lutte contre le Covid-19. Le 17 juillet dernier, elle a remis des dons de masques et d’équipement médicaux aux hôpitaux de la capitale.

Au mois d’avril, Ambatovy a décidé de suspendre ses activités en application des mesures relatives à l’état d’urgence sanitaire et après la découverte des cas parmi son personnel. Un mois plus tard, en mai, lors de la flambée des cas de contaminations au Covid-19 à Toamasina, l’usine d’Ambatovy a été mise en quarantaine.

Madagascar Tribune0 partages

Installation du nouveau gouverneur de la région Diana

L’installation des nouveaux gouverneurs se poursuit. Après la région Boeny, le gouverneur de la région Diana, Daood Arona Marisiky a été officiellement installé hier à Antsiranana. La cérémonie s’est déroulée en présence du président Andry Rajoelina, qui a fait le déplacement.

Lors de son allocution, le chef de l’Etat a affirmé que le développement devrait partir de la base tout en poursuivant qu’aucune région, ni district ne sera pas oublié dans les actions au développement.

En matière de santé, et de lutte contre le coronavirus, Andry Rajoelina accompagné de son épouse s’est rendu au CHU de Tanambao I, le couple présidentiel y a remis des équipements médicaux destinés à la lutte contre le Covid-19. L’établissement a été équipé de concentrateurs d’oxygène, d’un appareil de radiologie numérique mobile, d’EPI, des masques, des gants chirurgicaux, des kits de tests PCR et des médicaments.

Madagascar Tribune0 partages

Le projet Ambatovy projette de reprendre ses activités

Sumitomo Corporation, premier actionnaire au sein du projet Ambatovy, cherche à reprendre ses activités aussi tôt que possible. Ses activités de production du nickel et du cobalt ont été temporairement suspendues depuis plusieurs mois. A cause de la propagation du coronavirus dans la ville de Toamasina, des centaines d’employés étrangers ont dû être rapatriés dans leur pays d’origine et les salariés mis au chômage technique.

Ces derniers jours, la compagnie, avec l’appui de l’ambassade du Japon à Madagascar, multiplie les actions et les lobbys auprès de l’Etat malgache pour pouvoir reprendre ses activités. Deux semaines plus tôt, le 13 juillet dernier, l’ambassadeur du Japon, Yoshihiro Higuchi s’est entretenu en visioconférence avec le ministre des Mines et des ressources stratégiques, Fidiniavo Ravokatra à ce propos.

Le projet Ambatovy est le plus grand investissement du Japon à Madagascar et joue un rôle important dans le développement économique et social à Madagascar, avance l’ambassadeur japonais. Il sollicite ainsi l’assistance du gouvernement malgache afin que la production puisse être reprise dans le plus bref délai et dans les meilleures conditions.

En attendant cette reprise très attendue des activités d’Ambatovy, Sumitomo Corporation se montre généreuse envers l’Etat malgache et continue d’appuyer les efforts du gouvernement dans le cadre de la lutte contre le Covid-19. Le 17 juillet dernier, elle a remis des dons de masques et d’équipement médicaux aux hôpitaux de la capitale.

Au mois d’avril, Ambatovy a décidé de suspendre ses activités en application des mesures relatives à l’état d’urgence sanitaire et après la découverte des cas parmi son personnel. Un mois plus tard, en mai, lors de la flambée des cas de contaminations au Covid-19 à Toamasina, l’usine d’Ambatovy a été mise en quarantaine.

Madagascar Tribune0 partages

91 décès enregistrés en deux mois

Les décès liés au coronavirus s’accroissent de jour en jour. En 2 mois et 9 jours, Madagascar a enregistré 91 décès liés à la Covid-19. Hier, 6 nouveaux décès ont été recensés, dont 3 à Analamanga, 3 autres dans la région Boeny.

D’autre part, 395 nouveaux cas positifs ont été recensés dimanche dernier, selon le dernier rapport du CCO-Covid-19. Le nombre total de contaminations dans toute la Grande Ile est désormais de 9 690 cas.

 Nouveaux cas de contamination : 395

306 cas sur 666 tests PCR réalisés 89 cas sur 220 tests GeneXpert Analamanga : 269 cas positifs Alaotra-Mangoro : 52 Bongolava : 29 Boeny : 10 Diana : 9 Anosy : 6 Sava : 5 Itasy : 3 Analanjirofo : 3 (tous à Mananara Avaratra) Atsimo Atsinanana : 3 (tous à Vangaindrano) Sofia : 2 Ihorombe : 1 Localisation des 3 derniers cas : non communiquée

 Nouveaux cas de guérison : 243

196 guéris en traitement à domicile à Analamanga 47 guéris dans les hôpitaux ou autres centres de traitement, dont : CHU de Befelatanana : 12 CHU d’Anosiala : 8 Fenoarivo : 4 CNAPS de Vontovorona : 2 CTC Ivato : 1 Analanjirofo : 8 Antsirabe : 4 CHU d’Andrianjato Fianarantsoa : 3 Bongolava : 3 CHU Toliara : 1 Vatovavy Fitovinany : 1

 Malades souffrant de la forme grave : 88

CHU de Befelatanana : 49 HJRA : 17 Anosiala : 5 Andohatapenaka : 2 HOMI de Soavinandriana : 1 Fenoarivo : 3 Antsirabe : 5 CHU d’Andrainjato Fianarantsoa : 3 Boeny : 2 Toliara : 1

 Dernier bilan :

Confirmés : 9 690 Guéris : 6 260 Malades sous traitement : 3 339 Formes graves : 88 Décès : 91

 Tests PCR effectués : 38 587 (entre le 19 mars et le 26 juillet)

Madagascar Tribune0 partages

91 décès enregistrés en deux mois

Les décès liés au coronavirus s’accroissent de jour en jour. En 2 mois et 9 jours, Madagascar a enregistré 91 décès liés à la Covid-19. Hier, 6 nouveaux décès ont été recensés, dont 3 à Analamanga, 3 autres dans la région Boeny.

D’autre part, 395 nouveaux cas positifs ont été recensés dimanche dernier, selon le dernier rapport du CCO-Covid-19. Le nombre total de contaminations dans toute la Grande Ile est désormais de 9 690 cas.

 Nouveaux cas de contamination : 395

306 cas sur 666 tests PCR réalisés 89 cas sur 220 tests GeneXpert Analamanga : 269 cas positifs Alaotra-Mangoro : 52 Bongolava : 29 Boeny : 10 Diana : 9 Anosy : 6 Sava : 5 Itasy : 3 Analanjirofo : 3 (tous à Mananara Avaratra) Atsimo Atsinanana : 3 (tous à Vangaindrano) Sofia : 2 Ihorombe : 1 Localisation des 3 derniers cas : non communiquée

 Nouveaux cas de guérison : 243

196 guéris en traitement à domicile à Analamanga 47 guéris dans les hôpitaux ou autres centres de traitement, dont : CHU de Befelatanana : 12 CHU d’Anosiala : 8 Fenoarivo : 4 CNAPS de Vontovorona : 2 CTC Ivato : 1 Analanjirofo : 8 Antsirabe : 4 CHU d’Andrianjato Fianarantsoa : 3 Bongolava : 3 CHU Toliara : 1 Vatovavy Fitovinany : 1

 Malades souffrant de la forme grave : 88

CHU de Befelatanana : 49 HJRA : 17 Anosiala : 5 Andohatapenaka : 2 HOMI de Soavinandriana : 1 Fenoarivo : 3 Antsirabe : 5 CHU d’Andrainjato Fianarantsoa : 3 Boeny : 2 Toliara : 1

 Dernier bilan :

Confirmés : 9 690 Guéris : 6 260 Malades sous traitement : 3 339 Formes graves : 88 Décès : 91

 Tests PCR effectués : 38 587 (entre le 19 mars et le 26 juillet)

Madagascar Tribune0 partages

91 décès enregistrés en deux mois

Les décès liés au coronavirus s’accroissent de jour en jour. En 2 mois et 9 jours, Madagascar a enregistré 91 décès liés à la Covid-19. Hier, 6 nouveaux décès ont été recensés, dont 3 à Analamanga, 3 autres dans la région Boeny.

D’autre part, 395 nouveaux cas positifs ont été recensés dimanche dernier, selon le dernier rapport du CCO-Covid-19. Le nombre total de contaminations dans toute la Grande Ile est désormais de 9 690 cas.

 Nouveaux cas de contamination : 395

306 cas sur 666 tests PCR réalisés 89 cas sur 220 tests GeneXpert Analamanga : 269 cas positifs Alaotra-Mangoro : 52 Bongolava : 29 Boeny : 10 Diana : 9 Anosy : 6 Sava : 5 Itasy : 3 Analanjirofo : 3 (tous à Mananara Avaratra) Atsimo Atsinanana : 3 (tous à Vangaindrano) Sofia : 2 Ihorombe : 1 Localisation des 3 derniers cas : non communiquée

 Nouveaux cas de guérison : 243

196 guéris en traitement à domicile à Analamanga 47 guéris dans les hôpitaux ou autres centres de traitement, dont : CHU de Befelatanana : 12 CHU d’Anosiala : 8 Fenoarivo : 4 CNAPS de Vontovorona : 2 CTC Ivato : 1 Analanjirofo : 8 Antsirabe : 4 CHU d’Andrianjato Fianarantsoa : 3 Bongolava : 3 CHU Toliara : 1 Vatovavy Fitovinany : 1

 Malades souffrant de la forme grave : 88

CHU de Befelatanana : 49 HJRA : 17 Anosiala : 5 Andohatapenaka : 2 HOMI de Soavinandriana : 1 Fenoarivo : 3 Antsirabe : 5 CHU d’Andrainjato Fianarantsoa : 3 Boeny : 2 Toliara : 1

 Dernier bilan :

Confirmés : 9 690 Guéris : 6 260 Malades sous traitement : 3 339 Formes graves : 88 Décès : 91

 Tests PCR effectués : 38 587 (entre le 19 mars et le 26 juillet)

L'express de Madagascar0 partages

Hôte de l’ADN – Un cador de l’International Liberal dans nos murs

Secrétaire général de l’International Liberal, Emil Kirjas est, à Madagascar, depuis hier. Sa visite consiste en un échange avec le parti ADN pour voir comment la fédération mondiale peut aider à l’amélioration de la situation dans le pays.

Une grande opportunité. Selon Emil Kirjas, secrétaire général de l’Inter­national Liberal, être membre du réseau international des partis libéraux, ouvre d’énormes opportunités. En réponse à l’invitation du parti Antoka sy dinan’ny Nosy– Arche de la Nation (ADN), c’est justement, pour capitaliser ces opportunités que ce cador de la fédération mondiale des entités politiques libérales est, à Mada­gascar. Une première dans l’histoire de la pratique politique, dans la Grande île.À son arrivée de Londres, à l’aéroport d’Ivato, hier, l’homme politique a déclaré: « Je suis heureux d’être parmi mes amis, mes collègues. J’ai beaucoup appris de Madagascar, par le biais de mes amis de l’ADN. (…) je suis fier d’être ici parmi mes collègues pour parler, débattre, échanger avec eux de ce que l’on peut faire sur la scène nationale et internationale, sur le plan politique, pour améliorer la vie de tout le monde dans ce pays ».Fort d’un important réseau de partis politiques dans le monde, et de 70 ans d’existence, l’International Liberal, « donne une opportunité de faire des échanges d’idées, de projet », a indiqué celui qui a été l’un des plus jeunes ministres de la Macédoine. L’atout de « cette grande famille dont est membre depuis mai, le parti ADN », comme il l’a souligné, est, aussi, que plusieurs de ses membres sont, soit au pouvoir, soit des élus dans les Parle­ments de leur pays.En Afrique, la Côte d’Ivoire, le Sénégal, ou encore, le Maroc, sont, par exemple, des pays dirigés par des libéraux. Comme l’affirme l’ancien ministre des Affaires étrangères macédonien, ceci permet « de voir comment des projets ayant réussi ailleurs peuvent être modifiés et adaptés à Madagascar, par exemple ». Il a joute que « cela ouvre, également, de grandes opportunités de faire la promotion du pays, des opportunités qui existent ici ».

Idées et valeursEmil Kirjas, a également, abordé les opportunités données par l’International Liberal, à ses membres en perspective des joutes électorales. « Nous sommes là pour soutenir les idées, d’assister aussi, dans la manière de les présenter, dans la façon dont le parti en lice présente sa politique. Pour l’appuyer dans la manière, il présente les opportunités après les élections », explique le secrétaire général. Emil Kirjas fait remarquer, par ailleurs, « l’énorme opportunité », qui se présente pour un gouvernement libéral.Durant l’entretien, hier, l’hôte de l’ADN, a mis en exergue le fait que l’Interna­tional Liberal défend sur tous les fronts, jusqu’aux Nations Unies, où il dispose d’un statut consultatif, les idées et valeurs qui lui sont chères. Des idées nobles que sont la démocratie, le respect des droits de l’homme, ou encore, l’éthique politique. Des valeurs qui sont les critères d’adhésion à la fédération des libéraux. « Nos critères pour devenir membre sont difficiles. Nos amis ont bien appris cela », indique Emil Kirjas, parlant du parti ADN.Ayant accueilli ce dernier à l’aéroport, hier, Edgard Razafindravahy, chef de file national du parti ADN a soutenu : « C’est ça faire de la politique de manière professionnelle. Il s’agit de défendre des idées et des valeurs, d’éduquer, de partager ses expériences. Faire de la politique, ce n’est pas juste, rassembler une foule pour descendre dans les rues ».Sur la pratique politique, à Madagascar, justement, Emil Kirjas déclare que « de ce que j’ai appris, on peut faire les choses d’une meilleure façon, de manière à ce que les choses aillent dans le sens du développement. C’est pour cela que nous sommes ici, pour avancer nos idées, pour voir comment le gouvernement à venir va présenter un nouveau programme pour améliorer les choses ».

Andry Rialintsalama et Garry Fabrice Ranaivoson

L'express de Madagascar0 partages

Droit de travail – Les employés de l’informel mal payés et sans recours

Nelly Rakotobe traite du salaire des employés dans son ouvrage qu’elle a présenté hier. Les participants à cet évènement ont exprimé leurs soucis.

Nous n’avons pas touché notre salaire depuis deux mois. Nous n’avons pas de syndicat au niveau de l’entreprise mais le seul moyen pour lutter contre cette injustice est de consulter un inspecteur de travail », se plaint Elysé Rakotoarisoa, un employé dans un entreprise du secteur informel. Beaucoup de travailleurs  ne jouissent pas de leur droit de travail. Nelly Rakotobe Ralambondrainy, premier président honoraire de la Cour Suprême de Mada-gascar et enseignante de droit dans des établissements supérieurs, l’a confirmé lors de la présentation officielle de la troisième édition de l’ouvrage intitulé  »Les relations individuelles de travail », hier à la Cour Suprême Anosy. »80% des travailleurs dans les secteurs informels  sont mal payés» , explique t-elle. Elle ajoute qu’«il est normal que les travailleurs, dans le secteur informel, soient mal payés car ces entreprises ne paient pas d’impôt, ne se déclarent pas à l’État surtout les gargotes chinoises, qui ne sont pas inscrites à la contribution».

Limité par le SmigMême dans les secteurs formels, les gens sont mal payés mais pour d’autres raisons. «Le salaire des Malgaches est limité par le salaire minimum interprofessionnel garanti (SMIG). Actuellement, il est évalué à 155 523 ariary. Pour ne pas être poursuivi par l’État, les entreprises paient un peu plus de ce salaire minimum sans considérer les expériences et les compétences ainsi que les diplômes des employés», explique un responsable de ressources humaines qui a requis l’anonymat. Les secteurs informels fleurissent à Madagascar malgré les efforts de suivi des ministères concernés. «On peut détecter les secteurs informels grâce aux différents ministères mais il faut inciter aussi les entreprises à s’intégrer à être formelles. Il s’agit d’une volonté politique car c’est un manque à gagner pour l’État», affirme Andria-nadison, le directeur général de l’université privée Estiim, lors d’un débat sur l’éducation syndicale à l’hôtel le Pavé Antaninarenina le 22 juillet. 85% des entreprises à Madagascar sont informels actuellement.

Ouvrage – Les lois du travail à la loupe 

Nelly Rakotobe Ralambondrainy a conçu un ouvrage sur les lois de travail avec Ignace Rakoto qui est un historien, ancien ministre et membre titulaire de l’Académie Malgache, décédé en novembre 2013.  Cet ouvrage cible les directeurs de ressources humaines, les employeurs et les employés, les juges et les avocats sur les règles essentielles du droit malgache du travail, les notions indispensables à l’application de la législation du travail et le droit de travail.  »Il faut que les acteurs dans le monde du travail connaissent les règlements et les  lois sur le travail. Les employés revendiquent leurs droits selon la loi et les employés respectent ces employés en termes de congé, salaire. Si chacun respecte ses responsabilités, il n’y aura plus de grèves », explique Nelly Rakotobe Ralambondrainy.

Mamisoa Antonia

L'express de Madagascar0 partages

Ambanja – Arrestations dans un gisement de saphir

La police et la gendarmerie ont été dépêchées dans un gisement de saphir à Adampy Ambanja. Un groupe d’exploitants illicites a envahi les lieux. 

Rafle d’exploitants illicites dans un gisement de saphir à Andampy Ambanja. Réquisitionnés  par l’Organe Mixte de Conception (OMC), conduit  par le chef de district, un peloton de gendarmes et de policiers a été dépêché sur le site d’exploitation, enfoui dans la brousse, à une vingtaine de kilomètres du chef lieu de district.«Cinquante personnes ont été arrêtées. Elles sont placées en garde à vue et seront  présentées devant le parquet dans le respect du délai légal. L’opération s’est déroulée sans affrontement. Aucun blessé n’est à déplorer», a indiqué le commandant de la brigade territoriale de la gendarmerie nationale à Ambanja.Informé d’une effrayante ruée de chercheurs de saphir qui fait des ravages à Andampy depuis près d’une semaine, le directeur régional des mines du Diana s’en est remis à l’OMC d’Ambanja, qui d’emblée a lancé une opération «coup d’arrêt».La horde d’exploitants qui a investi les environs ont envahi des rizières et des champs, mettant ainsi à mal des terres arables ainsi que des domaines privés.

Passage au parquet«Environ deux cents chercheurs de saphir, dont des femmes et des mineurs, ont été dénombrés mais beaucoup d’entre eux ont pris la fuite avant l’arrivée des forces de l’ordre. Les autorités ont fait d’une pierre deux coups. Non seulement l’expulsion s’est déroulée sans anicroche, mais des personnes mouillées dans ces exploitations illicites ont été aussi prises sur le fait. Après cet assainissement, c’est le calme plat », a expliqué le commandant de  brigade.Police et gendarmerie ont travaillé de concert lors des enquêtes préliminaires. Les interrogatoires ont été terminés mercredi et les suspects traduits devant le parquet hier. Des femmes figurent parmi les personnes entendues. Ce sont des familles toutes entières qui se sont ruées jusqu’à Andampy, sans autorisation ni permis, prises par la fièvre du saphir. Si certaines sont de la région, d’autres sont venues de très  loin, ne se doutant pas que leur Eldorado ne ferait pas long feu.

Andry Manase

L'express de Madagascar0 partages

15e anniversaire – Le parti TIM de nouveau débouté

La demande d’autorisation du parti TIM, de célébrer son 15e anniversaire, au stade de Mahamasina est de nouveau refusée. Le parti affirme se conformer à cette décision.

Prévisible. Le général Angélo Ravelonarivo, préfet de police d’Anta­nanarivo, a rejeté la demande d’autorisation faite par le parti « Tiako i Madagasikara » (TIM), de célébrer son 15e anniversaire, au stade municipal de Mahamasina, le 29 juillet. Une décision « collégiale », insiste-t-il. Un refus décidé donc, par l’Organe mixte de conception (OMC), d’Anta­nanarivo.Lors d’un entretien téléphonique, hier, l’officier général a expliqué que « compte tenu des événements qui se sont passés le 8 juillet, que nous qualifions de grave, nous avons décidé de refuser la demande d’autorisation du parti TIM ». À entendre les explications du préfet d’Antananarivo, il a préféré l’option de la prudence. L’ancien parti au pouvoir a déjà essuyé un premier refus le 8 juillet.Une interdiction appliquée par les forces de l’ordre qui ont été légion, à Mahamasina, le jour du8 juillet, pour sceller les entrées du stade. Le parti TIM a, cependant, continué à haranguer ses partisans à venir, à Mahamasina, jusqu’au dernier moment. Face à la barricade dressée par les éléments de l’État major mixte opérationnel (EMMO), Marc Ravalo­manana qui est aussi, président national du TIM, a décidé de tourner les talons « pour rentrer chez lui ».Au motif de raccompagner leur chef de file à son domicile,  un raz-de-marée des partisans de l’ancien chef d’État, a envahi les rues allant d’Anosy, à Faravohitra en passant par la place du13 mai. Durant l’échange d’hier, le général Ravelo­narivo, a indiqué que des « dispositifs de sécurité similaire aux jours précédant le 8 juillet vont être mis en place ».

RésignationLe préfet de police ajoute, par ailleurs, que « ce parti s’identifie dans l’opposition légaliste. J’espère que ses partisans respecteront cette décision. Dans le cas contraire, nous sommes prêts à agir ». Le « Tiako i MAdagasikara », hier après-midi, a encore convié ses partisans, à participer à une répétition de chorégraphie de Zumba dans le stade couvert de Mahamasina, prévue figurer parmi les animations, de ce samedi.À en croire les propos du député Félix Randria­mandimbisoa, président du groupe parlementaire TIM, à l’Assemblée nationale, devant la presse, en marge de cette séance, à 15 heures 30, le parti n’a pas encore, été notifié du refus décidé par l’OMC de la capitale. Une notification qui, visiblement, a été effective, en fin d’après-midi, car, en début de soirée, la formation politique anciennement, au pouvoir, a publié un commu­niqué de presse dans lequel elle affirme « se conformer », à la décision de la préfecture.« Nous estimons que la décision du préfet ressort d’un excès de pouvoir manifeste, mais dans un esprit d’apaisement et dans un souci de profond respect de la loi, nous nous yconformons », soutient le parti TIM. Dans sa missive, l’écurie politique de Marc Ravalomanana, se défend, également, d’avoir manifesté sur la voie publique, durant la journée du 8 juillet. « Il n’y a pas eu de manifestation sur la voie publique, les gens empêchés de pénétrer dans le stade malgré le jugement du tribunal administratif ont tenu à ramener le président Marc Ravalomanana à sa demeure, à Faravohitra ».Dans sa défense, le « Tiako i Madagasikara », ajoute, du reste, qu’« il n’y a eu aucun incident sur leur passage (…) les forces de l’ordre eux-mêmes l’ont attesté sur les différents médias ». Dans cette seconde tentative d’avoir l’autorisation d’utiliser le stade municipal, de Mahamasina, pour y célébrer son 15e anniversaire, le parti TIM a misé sur le sursis à exécution de la décision du préfet concernant le rendez-vous, du 8 juillet, prononcé par le tribunal administratif, la veille. Le communiqué d’hier, n’indique pas si le TIM fera une nouvelle opposition à la décision d’hier, devant la Justice, ou non. Le fait d’affirmer qu’il s’y conforme, semble, toutefois, indiquer une certaine résignation.

Andry Rialintsalama et Garry Fabrice Ranaivoson 

L'express de Madagascar0 partages

Exposition – « Imprimer la lumière » de Tolotra Ramboasolo illumine 

Après avoir longtemps travaillé en photo reportage et photo studio, Tolotra Ramboasolo s’oriente vers la sensualité. Il s’affirme dans les détails en finesse.

Prendre l’anatomie humaine comme support pour apposer des motifs lumineux afin de sortir une fresque qui fait exploser la sensualité à fleur de peau. Tel est le concept que  le photo­graphe Tolotra Tina Ramboasolo utilise. «Imprimer la lumière» est le thème de son exposition à l’Is’Art Galérie. Un langage du nu très artistique.Souvent, le nu dérange. Mais savoir jouer la subtilité de la forme du corps avec des motifs qui semblent donner une mélodie du bonheur charnel rend les œuvres du photographe Tolotra Tina Ramboasolo captivantes. Onze photos en noir et blanc conjuguant la sensualité avec délicatesse composent «Imprimer la lumière», le thème de son exposition à l’Is’Art Galérie Ampasanimalo qui va se tenir jusqu’au 10 août. Et son défi s’avère raffiné et dénoue toute forme de vulgarité à ses œuvres. Au contraire, chaque image offre une certaine poésie distillée. Les détails parlent d’eux-mêmes. Les courbes et les contrastes s’expriment merveilleusement bien. Un vrai travail de professionnel. Je reste professionnel dans la façon de faire cette discipline de la photographie. Que ce soit sur la manière de shooter et de traiter les photos, et aussi la façon de travailler avec mes modèles qui sont des Malgaches et aussi des étrangers.

TabouIci à Madagascar, le nu reste encore un tabou. Lors de mes expositions, le public semblait réticent au départ. Mais quand il voit ce que c’est, il arrive à apprécier le résultat à sa juste valeur artistique. C’est ma façon de l’éduquer pour cette forme d’art. Bientôt, je vais travailler avec des hommes comme modèles; et les filles vont laisser découvrir leur visage nous explique Tolotra Tina Ramboasolo  lors du vernissage hier à Ampasanimalo. Ce genre d’exposition, il le fait à rythme annuel. L’édition de cette année a été décalée d’une semaine pour offrir une exposition de qualité selon ses dires.Tolotra Tina Ramboasolo avoue qu’il est tombé dans la photo inopinément. Ses premiers clichés datent de 2009. «Je n’avais pas encore mon propre appareil photo à l’époque. C’est Toky Andrianjafitsara qui m’a initié aux techniques de prise de vue. Dans mes débuts, mon portfolio s’est composé de scènes de vie quotidienne. Ensuite, j’ai découvert une passion pour les photos clairs-obscurs. Depuis, j’ai un penchant pour les photos de spectacles et les photos de nuit. En rejoignant Absolute Sary, j’ai développé mes techniques en matière de photo reportage et photo studio. Depuis, la photographie est pour moi une passion et une profession. Maintenant, le nu artistique est ma forme d’expression», nous confie l’artiste.

Ricky Ramanan

L'express de Madagascar0 partages

Volley-ball - Jeux de la cjsoi – Les filles en lice à La Réunion

Madagascar sera en lice à la compétition de volleyball comptant pour les Jeux de la CJSOI à la Réunion, en début août. L’équipe nationale est en regroupement depuis un mois.

L’équipe nationale malga­che de volleyball, catégorie U18 filles, est en regroupement depuis un mois en vue de la participation de la Grande île aux jeux de la CJSOI (Jeux de la commission de la jeunesse et des sports de l’océan Indien).Dix joueuses ont suivi l’entraînement quotidien sous l’encadrement du directeur technique national de la fédération malgache de volleyball, Serge Saramba. La compétition de volley des Jeux des Iles destinés aux cadettes se déroulera du 1er au 6 août à l’île de la Réunion.« La majorité de ces joueuses retenues dans la liste finale faisaient partie de celles qui ont joué la coupe d’Afrique catégorie U18 sur le sol malga­che l’année passée », a souligné Serge Saramba. La sélection est à ossature Anala­manga. Cette ligue, qui dispute régulièrement son championnat pendant presque toute l’année, est représentée par cinq joueuses, deux pour la ligue de Boeny et une chacune pour Vakinankaratra, Ihorombe et Atsinanana.Le gabarit de nos joueuses n’est pas loin de celui des îles participantes, dont la taille moyenne de 1,70m toujours selon le directeur technique. En phase éliminatoire, la compétition se jouera en formule deux poules et les deux meilleures équipes seront qualifiées en demi-finales. Pour la discipline volleyball, sept pays seront en lice à cette version 2017 des jeux de la CJSOI à savoir Madagascar, la Réunion, Maurice, Seychelles, Comores, Mayotte et Djibouti.

Phase de préparation« La majeure partie du regroupement a été axée sur le travail intensif des défenses hautes et basses… Ces derniers jours, on a orienté l’entraînement à la mise au point finale sur la tactique et stratégie de jeu », a confié l’encadreur technique de l’équipe nationale. Madagascar a participé pour la dernière fois à la compétition de volleyball des jeux de la CJSOI en 2010, à la Réunion.La sélection malgache a terminé, lors de cette édition, à la deuxième place, battue par la formation seychelloise en finale. L’objectif est, cette fois, de faire mieux et de s’installer sur la plus haute marche. La délégation malgache composée de dix joueuses, accompagnées par le directeur technique national, s’envolera pour la Réunion en deux vagues.Une partie quittera le pays le dimanche 30 juillet et la deuxième le lundi 31 juillet. Les éliminatoires débuteront mardi prochain.

Liste des sélectionnées

1-Alfera (Centrale-Atsinanana)2-Andriantsimarofy Tahiry Hafaliana (Passeuse-Analamanga)3-Damarie Tondra Orea Augustina (Libero-Analamanga)4-Indriamihaja Gracia (Poste4/centrale-Boeny)5-Koloina Rahelinirina (Cantrale-Ihorombe)6-Julia Angela Rakotonarivo (Poste2-Analamanga)7-Sandratra Rakotondrainibe (Poste4/Centrale-Vakinankaratra)8-Holy Fandresena Ramahavalisoa (Poste2-Analamanga)9-Rina Ranaivomampianina (Poste4-Analamanga)10-Diane Razanadrafara (Poste4-Boeny)Coach : Serge Saramba

Serge Rasanda

L'express de Madagascar0 partages

Sambava – Un gang tue  dans une attaque armée

La mort a frappé à Amboatafo Sambava. Attaqué à son domicile par un gang armé, un chef de famille âgé de soixante-trois ans n’a pas survécu. La bande a sévi mardi soir aux alentours de 19 heures dans le quartier de Beanatsindra.Les assaillants voulaient s’emparer d’une somme s’éle­vant à 3,2 millions d’ariary, de source auprès de la compagnie territoriale de la gendarmerie nationale à Sambava.Bien que les malfaiteurs aient réussi leur coup, ces derniers ont tout de même levé la main sur le sexagénaire, le tailladant à l’arme blanche à plusieurs endroits de son corps.Lorsque les voleurs ont pris la fuite, la victime agonisante a été d’emblée transportée au centre hospitalier d’Ambilobe mais il a succombé à ses blessures pendant son évacuation.Une personne de l’entourage du défunt a été identifiée parmi les assaillants. Bien que suivi à la trace par la gendarmerie, il demeure, néanmoins, introuvable jusqu’à maintenant. Après l’attaque, deux gendarmes de la brigade territoriale d’Amboahan­gibe ont fouillé les environs mais les recherches se sont avérées infructueuses.

A.M.

L'express de Madagascar0 partages

Dôme RTA – « Vibe party » le jour J 

Devenu la marque de fabrique de la station de télévision RTA. « Vibe Party » est un événement programmant diverses animations et activités dédiées aux jeunes et à tous ceux qui aiment s’amuser après les examens. Ce sera au Dôme RTA à Ankorondrano, aujourd’hui à partir de 20 heures.L’événement se démarque par ses animations en continue qui promettent de réjouir les noctambules. Sur ce la soirée se composera de quatre ambiances différentes, c’est à dire une discothèque géante  animée par des Dj professionnels à l’instar de Dj Didds Deejay, Dj Willy Akademix et le fameux Dj Sniper. Un grand battle de sexy show et des concours de genre « Dab » et « Bendo » seront proposés durant la soirée pour les férus de la danse. D’autre part, il y aura d’autres animations à l’égal du « Live outdoor » et une discothèque en plein air. Des places VIP seront également disponibles pour ceux qui  veulent garder une part d’intimité tout en participant à la fête. Une affiche bien remplie est proposée au public, où la musique sera reine. Le tout sera agencé avec des artistes et des groupes de renom, adulés par le jeune public, conciliant aussi bien la musique urbaine que la musique tropicale.Jiolambups, Elodie, Kougar, Jiunyi, Babs, Kim’jah, Tsota, Mijah et la jeune Andriann se partageront la scène du Dôme RTA, assurant ainsi une fête enivrante. « La Rta est toujours à la conquête des meilleurs divertissements pour tous, mais surtout pour les jeunes. Ainsi Vibe Party sera  un moment unique que l’on partage dans la joie, l’allégresse et la bonne humeur la plus totale, c’est ce qui attend les jeunes qui viendront à cette Vibe Party,», affirme Naina Randria­mananjara, directeur de la Radio télévision Analamanga (RTA).

Sitraka Rakotobe

L'express de Madagascar0 partages

Protection de l’enfance – Un arnaqueur exploite une mineure

Des enfants victimes de violence sont hébergés dans des familles d’accueil à Nosy Be. Parmi eux, Martine, une adolescente exploitée par un arnaqueur.

Une adolescente tombe dans les bras d’un arnaqueur. Elle a à peine 16 ans, lorsqu’elle rencontre un homme qui a prétendu être un greffier.« Il m’a promis une belle vie, en me prenant comme femme. J’ai quitté les bancs de l’école à la suite de ses promesses. J’étais en classe de 4e », a raconté hier, la jeune fille que nous allons appeler Martine. Cet homme l’a arrachée à sa mère, alors qu’elle menait une vie paisible avec sa famille, à Antalaha. Il l’a emmenée à Nosy Be.« Il l’a placée chez une femme de même origine que lui. Il s’est enfui par la suite. Cette femme, qui ne les connaissait même pas, a refusé de garder la petite et nous l’a amenée. Elle était enceinte. Nous avons mené notre enquête et avons constaté que cet homme, qui l’a conduite à des kilomètres de chez elle, est un arnaqueur. Il demandait de l’argent à des personnes, il volait des motos. Il a été placé sous mandat de dépôt, depuis mars», explique Sousanah Yahyah, responsable du service de district du ministère de la Population, de la protection sociale et de la promotion sociale (MPPSPS) à Nosy Be.La petite Martine ne pouvait pas rentrer chez elle à Antalaha dans son état. Le ministère de tutelle l’a placée provisoirement chez une famille d’accueil. Ce dispositif est fonctionnel à Nosy Be, depuis octobre 2016.

Accueil temporaireLe Fonds des Nations Unies pour l’enfance (Unicef) est le partenaire technique et financier du MPPSPS dans ce programme. « Le placement d’un enfant dans une famille d’accueil est temporaire. L’objectif final est le retour de l’enfant dans le foyer familial. Ce dispositif permettra d’assurer l’assistance matérielle, morale et l’éducation de la victime. Il facilitera, par ailleurs, la reconstruction de la relation entre l’enfant et ses parents », explique le responsable du MPPSPS.Dix familles qui s’intéressent aux enfants, ont accepté d’accueillir de jeunes victimes de violences et d’exploitation. Six d’entre elles hébergent des victimes de maltraitance, dont Martine. Elles reçoivent un appui financier de 100 000 ariary par mois et des kits. Georgette, le chef de famille qui accueille Martine, joue avec assurance le rôle de mère pour sa petite protégée. « J’ai promis à sa mère de m’occuper d’elle comme si c’était mon enfant. La nuit, elle se plaint d’avoir mal aux dents. Je me réveille pour adoucir sa souffrance », indique-t-elle. Martine rentrera à Antalaha, quand elle aura donné naissance à son enfant. La séparation sera dure, entre sa mère de substitut et elle. Elles ont noué une relation mère-fille, depuis le mois d’avril, au moment  où elles ont commencé à vivre ensemble.

Miangaly Ralitera

L'express de Madagascar0 partages

Foi et conversion – Croissez et remplissez la terre

En l’espace de quelques années, les Églises, dites cadettes, ont fini par largement occuper le paysage urbain de la capitale. Il est beaucoup question de tentation et d’argent.  

Démons et merveilles. Marc Tatandraza, repris de justice autoproclamé pasteur d’église, a de nouveau fait parler de lui cette semaine. Sur les réseaux sociaux, il a affirmé vouloir disparaître « puisque plus personne ne veut de lui », Il faut savoir qu’il est aujourd’hui activement recherché par la police. En juin, l’individu a défrayé la chronique, brisant la sérénité de la petite ville de Soanierana-Ivongo, dans l’Est de Madagascar. Des civils s’en sont pris au temple de l’église néo-réformée Fivavahana Kristianina Miray (FKM) ayant Marc Tatandraza comme pasteur. Le prétendu pasteur, « dahalo niova fo », dahalo repenti comme il se définit, a été accusé par la foule de séquestrer des adolescentes et d’avoir abusé d’elles sexuellement. La foule en colère a brûlé le temple et poussé à s’enfuir Marc Tatandraza et certains de ses fidèles.Le conseiller du maire de Soanierana-Ivongo, quelques semaines après, a dû monter à Antananarivo, pour témoigner de la bonne foi des élus qui ont permis à cette association cultuelle d’être créée. Oui le maire, représentant de l’État a donné l’autorisation n°61/CR/SI-17 du 15 mai 2017 à l’association cultuelle d’exercer. « Parmi ceux qui ont délibéré figurent un prêtre et plusieurs autorités morales de la ville », se défend-il. Il n’est venu à personne l’idée de contester leur décision. Puis « une atteinte à la moralité manifeste ayant un impact sur la sécurité publique a été constatée », reconnaît-il. La commune a donc pris la décision d’annuler l’autorisation.Selon le ministère de l’Intérieur, neuf Églises sont aujourd’hui recensées à Madagascar. Il s’agit « d’institutions possédant leur propre organisation interne et où l’État n’intervient pas. », précise une  responsable. En revanche, les associations cultuelles, comme celle de Marc Tatandraza, doivent rendre compte et nécessitent au moins cent fidèles pour pouvoir être créées. Il existe actuellement deux cent soixante dix neuf associations cultuelles dans le pays. En l’espace de trois mois, indique une enquête, dix associations cultuelles ont été créées. Aujourd’hui, dans les moindres recoins de la capitale, fleurissent des « églises » dites cadettes, qui se sont démarquées de l’Église catholique et de celles regroupées au sein du FFPM, l’association des Églises protestantes de Madagascar.Seul le ministère de l’Intérieur peut autoriser l’officialisation des associations cultuelles. Leurs dirigeants doivent déposer une demande auprès de cette institution pour son ouverture. Ceci est régi par l’ordonnance N° 62-117 du 1er octobre 1962 relative au régime des cultes. Ainsi, ils peuvent avoir des réunions cultuelles qui  peuvent être tenues librement à l’intérieur de locaux privés. À condition, toutefois, qu’elles ne troublent, en aucune façon, l’ordre public et que les pratiques religieuses qui y sont exercées ne portent atteinte ni à la morale ni aux bonnes mœurs.

Solution immédiateTiana R., fonctionnaire au ministère de l’Intérieur perçoit la prolifération des Églises à Madagascar comme une bénédiction.« Moi -même en tant que mère de famille, je vis pleinement ma vie de chrétienne et je l’enseigne à mes enfants. » Elle pense que les financements extérieurs dont bénéficient ces églises cadettes, ont beaucoup aidé à leur développement. Ailleurs, le phénomène est perçu différemment. « Les gens veulent tout, tout de suite, ils veulent une solution immédiate à leur problème quotidien. Mais la foi ce n’est pas cela », estime Jary, membre actif du temple protestant de son quartier.Le pasteur Jean Louis Zarazaka, numéro deux de la FJKM, l’Église réformée de Madagascar, trouve même une explication politique au phénomène. « Le président Ratsiraka, en difficulté dans ses dernières années de pouvoir, a favorisé la montée du pasteur Mailhol. Marc Ravalomanana a encouragé la scission du FPVM d’avec la FJKM. L’instrumentalisation de la religion par le pouvoir politique vient, cependant, de la faiblesse des Églises, reconnaît-il. ÒDepuis 2009, la FJKM tente un rapprochement avec les Églises « dissidentes » cadettes. « La porte est ouverte », affirme le pasteur Zarazaka. Mais il reconnaît que pour beaucoup, les tentations ne sont pas loin. « Vous savez, chaque dimanche dans mon temple, nous pouvons récolter au moins sept millions d’ariary de quête. Si je décide de créer ma propre église avec cela, dans quelques années je pourrais m’acheter un hélicoptère. »

Ludovic Rabenatoandro, vicaire général de l’Église catholique – « Dieu respecte la volonté de chacun »

Pourquoi les gens s’en vont-ils ailleurs ?Le phénomène n’est pas nouveau. Il a existé depuis les origines. Les enseignements du Christ ne plaisent pas toujours forcément. Mais les enseignements de l’Église ne peuvent pas être changés. Il y a aussi une hiérarchie à respecter. Dieu a toujours respecté la volonté de chacun. Beaucoup de personnes, malheureusement, ne cherchent que ce qui leur fait plaisir. Je dois également souligner le fait que, par l’intermédiaire du Conseil œcuménique des Églises chrétiennes, les Églises dites traditionnelles font l’effort de se rapprocher.

Le dogme, les règles sont peut-être trop rigides ?Avant Vatican II, les règles, c’est vrai, étaient strictes. Vatican II a permis une plus grande ouverture, un plus grand assouplissement dans la pratique de la religion. C’est une question de choix. La mission de l’Église est d’enseigner, de baptiser. Ceux qui vont ailleurs, cherchent des miracles.

N’y a-t-il rien que la prière ne puisse faire ?Si l’on a vraiment la foi, si. Pour Jésus, celui qui aura patienté jusqu’au bout sera sauvé. Tout est question de persévérance. On ne peut, cependant, que constater la tendance, dans la société d’aujourd’hui, à tomber en déliquescence. Il y a un examen de conscience à faire.

Le fait d’être chrétien est-il un gage de bonne moralité ?Le chrétien est celui qui suit les pas et les enseignements du Christ. Mais ce n’est pas une carte d’identité. Ce n’est pas un droit. Dans l’Église catholique, le chrétien est celui qui suit le tre diem chrétien : le Jeudi saint : servir, le Vendredi saint, suivre la Sainte Croix, le Samedi saint : accepter d’être enterré.

Le pasteur Patrick Andrianarivo, chef de file de l’église évangélique Shine, célèbre le seigneur lors d’un réveillon évangélique

« Chercher le miracle »

Le décor est planté. Dans le gymnase couvert du Palais des sports de Mahamasina, une grande scène noire occupe toute la largeur de la fosse. Deux grands panneaux sur lesquels sont inscrits en grand « Chercher le miracle », dominent chaque côté, bien éclairé par les projecteurs savamment disposés tout autour. Au centre de la salle, face à la scène, opérateurs du son devant leur table de mixage et cameramen se tiennent prêts. L’écran géant quidomine le fond ne renvoie, pour l’instant, que de bribes d’images des fidèles à l’intérieur et à l’extérieur du palais.L’ambiance est celle des grands jours de spectacles. Les gens se saluent : « Que la grâce soit avec toi ! » Des personnes vêtues de blanc et de noir, membres du « staff », s’affairent un peu partout, vérifient si tout le monde est bien installé. La salle est archicomble. Il n’y a plus de place dans les gradins. C’était le 11 juin. L’Église « Shine » recevait en grande pompe un invité de marque en la personne de l’« apôtre » Jean Turpin, fondateur et pasteur du Centre de réveil international d’Ottawa, au Canada.Une mère et sa petite fille sont assises par terre. « J’ai préféré venir au culte de 14h30 (ndlr : il y a eu en tout quatre cultes ce jour-là). Il faut d’abord penser à faire la cuisine, donner à manger aux enfants. On ne peut pas compter sur l’homme pour faire cela. Il ne pense pas à ce genre de détail. » Cette maman est là, assise par terre avec son enfant parce qu’elle est persuadée que la prière peut tout.« Je compte aller au bureau du pasteur à Andravoahangy-ambony. Il vous reçoit en personne, vous savez. Mais il faut y aller très tôt. Les gens sont là-bas dès cinq heures du matin. » Près d’elle, une autre jeune femme en jean, sourire aux lèvres, devise tranquillement. Puis elle se secoue, comme prise soudainement d’un léger spasme. « Aujourd’hui, je sais que je vais recevoir la grâce, je le sais. J’en ai la chair de poule. » Son amie, assise près d’elle, acquiesce. « Les gens aiment Shine parce qu’ici, on prie autrement. »La chorale entre sur scène, suivie de la pasteure Fara Andrianarivo. Sa voix est douce, réconfortante même. Elle plaisante avec l’assistance, donne quelques directives, puis elle invite à la prière. Les bras se lèvent, les yeux se ferment. Les fidèles se laissent en même temps bercer par les chants. « À partir d’aujourd’hui, tout va changer ! », promet-elle. Elle prie pour ceux qui veulent trouver du travail, ceux qui veulent plus d’argent, « pour que tous les tracas du quotidien disparaissent enfin !» Chaque assertion est ponctuée de vibrants « amen » et« alléluia » scandés par l’assistance.Quand le bishop Patrick Andrianarivo fait son entrée dans la salle, entouré de ses gardes du corps, la ferveur est déjà montée d’un cran. Il va présenter son invité de marque et demande à la salle de lui réserver un accueil digne d’une star. Pendant plus de trois heures de sermon, Jean Turpin déclarera sa flamme à Madagascar, conseillera, avec emphase, aux fidèles de dire des choses gentilles, de sourire, de prier pour « vos ennemis, votre boss, le Président ». Il ajoute : « Accepter le Christ est une grâce. » Ce jour-là, l’apôtre Jean Turpin criera au miracle car, après la séance de prière et d’apposition des mains menée par ses soins et aidé des pasteurs de l’église Shine, plusieurs dizaines de personnes défileront sur scène se disant guéris de la cysticercose, de sinusite, de maux de tête ou de ventre.

Pasteur Etienne Zakazafy, secrétaire général du FFPM – « Celui qui croit doit vivre dans la crainte de Dieu » 

Pourquoi les gens s’en vont ailleurs ?Cela dépend de l’appel du Seigneur. C’est aussi un choix. Il n’y a pas d’obligation. L’Église est comme une sorte de filet qui attire ceux qui trouvent en elle un écho. Si la personne trouve, ailleurs, ce qu’elle recherche, on ne peut que respecter son choix. Ce qui compte, c’est la rencontre avec le Seigneur. Ce qui est positif avec ce phénomène, c’est que les Églises dites traditionnelles ne peuvent plus se contenter de la routine. Elles doivent se rénover.

Le dogme, les règles sont peut-être trop rigides.Rien ne peut être rigide si on le fait avec amour. Tout dépend de comment convaincre les croyants. Les Saintes Écritures disent que c’est avec la grâce que l’on reçoit les gens et non avec des règles. Cela ne veut pas pour autant dire que le laxisme doit primer. En bon chrétien, c’est aussi par les Saintes Écritures que les règles sont établies.

Le fait d’être chrétien est-il un gage de bonne moralité ?« L’homme sera sauvé par la grâce de Dieu », disent les Saintes Écritures. C’est sa foi qui forge l’homme, qui l’éduque et lui montre le bon chemin, dans la crainte de Dieu. La foi, c’est la vie. Si le comportement ne correspond pas à ce qui doit être vécu avec la foi, il ne peut y avoir de vertu. Celui qui croit, doit vivre dans la crainte de Dieu

Les fidèles de la mosquée des 67 ha, en juin dernier, au moment de la rupture du jeûne, lors du Ramadan

L’Islam à Madagascar – L’accent sur le vivre ensemble

Ni fanatisme ni haine. Alain Abou Bakary, président du Cercle de réflexion des musulmans à Madagascar plaide pour un islam de paix dans la Grande île. Pour lui, « ce qui se passe ailleurs ne nous concerne pas ». Il n’a aucun doute sur le fait que Madagascar est une terre d’islam. Pour appuyer ses dires, il fait appel à l’Histoire. « Les musulmans ont été les premiers à venir s’installer au IXe siècle », affirme-t-il. Il regrette cet oubli, « un fait de la colonisation qui a occulté exprès notre orientalité ».En mai dernier, sur internet, un article décrit « l’islam, une force tranquille à Madagascar ». Ilconstate que si « les musulmans constituaient en 2010, 1,1% de la population, ils représentent aujourd’hui 15% d’une population de 25 millions d’habitants. » Le ministère de l’Intérieur ne confirme pas ces chiffres, mais fait, par contre, état de onze associations cultuelles musulmanes. De plus en plus de Malgaches, issus d’autres confessions, sont séduits par les enseignements du prophète Mahomet. Hanta R. en fait partie. Jupe longue, bras entièrement couverts et voile sur la tête, elle passerait sans doute inaperçue aux alentours de la mosquée du quartier des 67ha sud, si ce n’est son fort accent rappelant le pays betsileo. « Je suis musulmane depuis cinq ans. J’étais catholique avant. Une amie m’a convaincue de venir une fois et j’ai aimé les choses que l’on enseigne ici. Avec l’islam, on ne dort pas le ventre vide. Il y a toujours un ami pour veiller sur toi. » Hanta R. attend la réponse à ses prières, comme cela se fait dans l’islam. Elle ne désespère pas d’être entendue.Alain Abou Bakary, lui, met l’emphase sur le vivre ensemble malgache. « Surtout en province. À Tana, c’est plus compliqué. » Lui, le « Merina valovotaka », résidant à Tana depuis trente ans, dit se sentir bien avec tout le monde. « J’ai du sang betsileo, vezo en moi. J’ai vécu en pays bara. Tous les musulmans n’ont pas cette chance. » Il est persuadé que les musulmans ne se sentent pas persécutés à Madagascar. « Mais après tout, tout est question de perception. »

Textes Rondro RamamonjisoaPhotos : Ihandry Randriamaro et  Tojo Razafindratsimba 

L'express de Madagascar0 partages

Décès de Monseigneur Zevaco

Monseigneur Pierre Zevaco, évêque émérite de Tolagnaro, évêque du diocèse de Tolagnaro, est décédé, mardi, à Fianarantsoa. Diplômé en médecine, spécialisé en pédiatrie, l’évêque Zevaco, a été ordonné prêtre, en juin 1959, et nommé évêque de Tolagnaro, anciennement diocèse de Fort Dauphin, par le pape Paul VI, en septembre 1968. Outre sa réputation d’être proche des personnes les plus démunies, le religieux a, également, contribué à la réhabilitation de la cathédrale de Tolagnaro. L’évêque Zevao s’est éteint à l’âge de 93 ans, etsera inhumé, ce jour, à Fianaran­tsoa, deux jours avant son 93e anniversaire.

L'express de Madagascar0 partages

Cyclone – Quand le Sud vient en aide au Nord 

Dix tonnes de maïs d’Ihorombe ont été distribués aux victimes du cyclone Enawo à Maroantsetra en juin et en juillet. Les produits, remis par la société Tozzi Green au chef de district en mai, ont été répartis aux différentes familles qui en avaient besoin après le passage du cyclone Enawo. La campagne de distribution avait démarré fin juin après une enquête réalisée par le district. Plus de 2 000 familles issues des fokontany les plus touchés ont ainsi pu obtenir environ 4 kilos de maïs chacune.Maroantsetra avait été l’un des districts les plus touchés par le passage du cyclone Enawo en mars. Au moins huit morts et des milliers de déplacés ont été enregistrés dans cette région du Nord-Est du pays. Celle-ci étant fortement enclavée même en période non cyclonique, l’acheminement des aides et l’identification des victimes y prennent souvent plus de temps qu’ailleurs.Cultivant le maïs sur 3 500 ha dans sa ferme d’Ihorombe, la société Tozzi Green a choisi de soutenir les habitants de Maroantsetra où, en tant que maison mère de la société Hydelec, productrice d’électricité, elle dispose d’une centrale hydroélectrique.

L'express de Madagascar0 partages

Hariandry Razakaboana – « Remporter le championnat, ce serait top »

Première victoire en rallye. Qu’est-ce que vous avez ressenti au terme de la dernière épreuve spéciale ?Une joie immense bien évidemment, puisque nous avions atteint notre objectif, malgré le fait que d’autres équipages évoluaient sur des voitures plus puissantes. J’ai débuté en slalom en 2010 et j’ai décroché deux victoires depuis, à Ambato­mirahavavy en 2010 avec une Volkswagen Golf et en 2013 à Lazaina avec une Seat Ibiza. J’ai surtout fourni des efforts ces deux dernières années et aujourd’hui, ces efforts ont payé.

Plusieurs équipages sont partis à la faute à Fiana­rantsoa. Comment avez-vous fait pour éviter les pièges et boucler le rallye sans accroc ?Je dirai que notre principal avantage était que nous roulions sans pression. De plus, nous étions derrière et donc en position de chasseurs. À partir de la troisième journée de samedi, on était en tête avec une vingtaine de secondes d’avance. Les autres coureurs ont pris plus de risque pour essayer de nous rattraper. Alors que de notre côté, nous étions plus zen.

À vos débuts en rallye, vous étiez au volant d’une Peugeot 104. Comment s’est passé votre apprentissage avec celle-ci et puis l’adaptation à la Subaru ?Bien évidemment, j’ai affûté peu à peu mon pilotage depuis mes débuts. Mais j’ai surtout appris à bien gérer la mécanique. Sur la 104, une deux-roues motrices plus fragile donc, la gestion de la machine est primordiale pour pouvoir boucler un rallye. Ce qui a grandement facilité mon adaptation à la Subaru, qui est plus solide.

Le Rallye Haute Matsia­tra était à sa première édition. Votre avis sur celle-ci ?Au niveau organisation, c’était OK. Concernant les pistes, elles sont pour la plupart en bon état, même si on a tout de même rencontré quelques portions cassantes. Il y a également plusieurs changements de revêtements. On passe par de la boue ou des gravillons par moment.

Cinquième du Rallye Elf Michelin, quatrième du Rallye Asacm et premier lors du Rallye Haute Matsiatra, votre parcours impressionne. Comment se présente la suite de votre saison ?Nous allons faire de notre mieux pour garder ce rythme. Notre objectif sera de monter sur le podium pour les prochaines courses. Après, si on arrive à remporter le championnat, tant mieux, ce serait top.

Propos recueillis par Haja Lucas Rakotondrazaka

L'express de Madagascar0 partages

Natation - Mondiaux – Deux meilleurs temps pour Nomena

Les nageurs de la Grande île réalisent des records et aussi meilleurs temps aux XVIIes Mondiaux de Budapest. Outre les trois nouveaux records nationaux de Mickaël Rasolon­jatovo (200mNL) et Élodie Razafy (100m dos et 50m dos), le numéro 2 malga­che, Lalanomena Anthony Andria­ni­rina a, pour sa part, actualisé son propre meilleur temps.Hier, le nageur de Cosfa a bouclé les 200m dos en 2’21 »04 contre son meilleur chrono de 2’26, effectué lors du championnat de Mada­gascar sur grand bassin en février à Vontovorona. Avant hier, Nomena a parcouru les 200m quatre nages en 2’23 »97 contre 2’25, son meilleur temps qui date du dernier sommet national.Ce jour, la nageuse locale, Sarah Valisoa Raharvel entre en lice et prendra le départ des 50m papillon et demain, l’épreuve de 50m nage libre. L’équipe malgache clôturera en beauté sa participation à ces Mondiaux par le relais mixte 4x100m nage libre, ce samedi.

S.R.

L'express de Madagascar0 partages

Drame à Ambohidahy

Une passante a été griève­ment blessée à Ambohidahy hier, lorsqu’un échafaudage s’est abattu sur elle. Elle a dû être évacuée d’urgence à l’hôpital d’Ampefiloha.

L'express de Madagascar0 partages

En cadence, la danse de l’exhumation

Le Malgache a le culte des ancêtres très poussé. Aussi est-ce une tâche qui s’impose à tous, sans distinction de rang ni de fortune, sauf dans certaines régions et dans certains clans, de célébrer les morts enterrés depuis un certain temps, avec la plus grande pompe possible, vers la fin de la saison sèche.Jadis, le Famadihana, « cérémonie de retournement des morts et le plus souvent changement du tombeau » (Marie-Robert Rason) dure plusieurs jours, au moins trois. Il est aussi l’occasion pour différents groupes de Mpilalao (troupes de Hira gasy) de rivaliser de maîtrise devant les connaisseurs. C’est pour eux un véritable concours sur lequel se forge leur renommée. La veille au soir, les proches parents des défunts vont au tombeau. Là, se tournant vers les quatre points cardinaux, le doyen d’âge évoque les morts, les prévient que le lendemain ils seront transportés dans une sépulture meilleure.Le jour dit, de bonne heure, les invités arrivent vêtus de leurs plus beaux habits. Le cortège se forme. Viennent d’abord les esclaves qui chantent à tue-tête, puis les Mpilalao dont les roulements de tambour se répercutent « dans les vallons noyés de brume ». Arrivent ensuite les parents portés à dos d’esclaves. « Certains d’entre eux revêtent fièrement, et en dansant, les lambamena (suaires) qui doivent envelopper les dépouilles mortelles. » Enfin, les invités en filanjana ferment le cortège qui ondule lentement pour arriver au tombeau quand, vers l’Est, le ciel commence à rougir, car le tombeau ne doit s’ouvrir qu’avec les premiers rayons du soleil.Un long moment de silence est respecté, coupé de sanglots et de pleurs. Chacun évoque ses aïeuls. Les parents pénètrent dans le tombeau, enveloppent les dépouilles des revers de nattes neuves et de lamba blanc, et les portent dehors à bout de bras, où elles sont accueillies par desclameurs. Le doyen d’âge, debout au sommet du tombeau, crie quand on sort un mort: « Qui va là ? » À l’intérieur, une voix répond par le nom du défunt ou de la défunte. Alors chants et musique éclatent pendant que l’on promène les restes mortels, toujours à bout de bras au-dessus des têtes, jusqu’à une tente sous laquelle ils doivent passer la nuit et où, selon un rite bien précis, on les revêt de nouveaux et riches lambamena. La cérémonie commence ainsi pour tous les habitants du tombeau.« Détail curieux : il est interdit à ceux qui ont touché les cadavres de se laver les mains avant d’avoir mangé et de s’être gorgés de rhum. » De nombreux bœufs ont été abattus la veille ou très tôt le matin pour être servis « aux repas pantagruéliques » qui dureront toute la journée et toute la nuit, arrosés de dames-jeannes entières de rhum dont on se fait un devoir de vider. Les Mpilalao entrent enfin en lice, « soigneusement gavés et grisés ». Les différentes troupes font assaut de brio. « Les roulements de tambour, les battements des mains, les hurlements des spectateurs qui attisent la rivalité des différents groupes et les cris perçants des enfants qui se battent dans la poussière, donnent une impression étourdissante. »À l’aube du troisième jour, les parents des morts se remettent à pleurer, aidés un peu en cela par l’ivresse de l’alcool de la nuit. Puis on transporte les dépouilles mortelles emmaillotées dans leurs nouveaux suaires vers leur nouvelle (ou ancienne) dernière demeure, que l’on ne doit pas toutefois gagner directement. Le Mpanandro (devin) consulté pour déterminer la date du Famadihana, l’heure d’ouverture et de fermeture du tombeau…, a pour cela établi un itinéraire assez détourné. Et il est vrai que l’on fait de nombreux détours, « ce qui dans l’esprit des assistants aura pour effet de leur retarder aussi longtemps que possible, l’heure de la mort ». Tout cela, toujours au son de la musique assourdissante des Mpilalao.Arrivées à destination, les dépouilles sont à nouveau promenées à bout de bras, trois ou sept fois autour du tombeau, accompagnées de clameurs joyeuses. Elles sont enfin disposées à l’intérieur et l’on scelle la pierre d’entrée. On se dispute les nattes neuves et les lamba blancs qui ont enveloppé les dépouilles en sortant du tombeau. Quiconque s’en saisira, sera fortuné toute sa vie ; veuf, l’homme aura bientôt une compagne qui fera son bonheur ; stérile, la femme sera bientôt mère ; pauvre, on deviendra riche sans tarder… Et la musique et la danse reprennent furieusement avant qu’un orateur fasse l’éloge des morts et vante les actions d’éclat qui ont illustré leur vie. Enfin, l’assistance se sépare.

Texte : Pela Ravalitera - Photo : Archives personnelles

L'express de Madagascar0 partages

Entrepreneuriat  en pleine nature

Le centre d’excellence en Entrepreneuriat organise du 17 au 19 Août, « Entre­preneurship camp » à Soaland Antsirabe. Une opportunité pour appren­dre à se découvrir en entre­preneur et qui permet aux jeunes professionnels, étudiants, entrepreneurs et entreprises de se former, de se partager des expé­riences, de recevoir des team buildings en pleine nature.

L'express de Madagascar0 partages

Boeny – Vers une gestion foncière décentralisée

À point nommé. Le litige foncier arrive en tête des sujets traités au niveau du tribunal de Maha­janga. La rencontre organisée par le ministère auprès de la Présidence chargé des Projets présidentiels, de l’Aménage­ment du territoire et de l’équipement (M2PATE) et qui se tient pendant deux jours au Zahamotel à Amborovy, sera l’occasion d’aplanir les dissensions et de remettre de l’ordre au niveau du service foncier à Mahajanga. Un tel atelier s’est déjà tenu dans les zones Est et Centre-Ouest. Quant à la zone Ouest,  elle est composée des régions Sofia, Betsiboka et Boeny.«L’atelier servira à rappeler les responsabilités de tout le monde et le fonctionnement du guichet foncier, le BIF, ainsi que le rôle des maires. L’objectif est de recueillir des pistes pour élaborer un cadre stratégique en vue d’améliorer et de consolider la mise en œuvre de la gestion foncière décentralisée (…)», explique le directeur général du service foncier (DGSF), Lala Hanitra Rasendrasoa, en présence du coordonnateur national de la cellule de Coordination de la réforme foncière.La présentation des enjeux actuels de la gestion foncière décentralisée et de ses perspectives ainsi que les nouvelles attributions des collectivités territoriales décentralisées en matière foncière,  a illustré la journée d’hier. Les lacunes et les failles juridiques, l’identification des diverses contraintes et des pistes d’orientation sur trois thèmes ont étéégalement discutées. Les réformes sur la loi des propriétés privées non titrées ont été enfin l’un des points saillants de l’atelier.

Vero Andrianarisoa

L'express de Madagascar0 partages

Mort dans  la rue

Découverte macabre à la Petite Vitesse Analakely hier matin. Un homme âgé d’une quaran­taine d’années a été retrouvé mort en pleine rue. Aucune  blessure n’a été relevée sur la dépouille. Le corps est placé à la morgue de l’hôpital d’Ampefiloha.

L'express de Madagascar0 partages

Corps attaché contre un cacaoyer

Le corps inerte d’un individu âgé de trente deux ans a été découvert attaché contre un cacaoyer à Andrano­karana Ambanja mardi matin vers 10 heures. La thèse criminelle est privilégiée bien qu’aucun suspect ne soit jusqu’à maintenant identifié.

L'express de Madagascar0 partages

Usine d’assemblage de tracteurs

Des investisseurs indiens  de l’Escort Limited ont présenté un projet d’im­plan­tation d’usine d’assem­blage de tracteurs à Mada­gascar, au Président Hery Rajaonarimam­pianina. Ils prévoient, en outre, de faire venir des tracteurs et des engins agricoles pour appuyer la mécanisation agricole du pays. Un accord a été signé, hier, dans le cadre de cette coopération bilatérale.

L'express de Madagascar0 partages

Taux de croissance  en augmentation

Le taux de croissance 2017 est évalué à 4,5% s’il était de 4% en 2016 et 3,2% en 2015. Abdelkerim Bendjeb­bour, représentant résident de la Banque africaine de développement (BAD) reconnaît cette performance économique du pays.

Midi Madagasikara0 partages

Pauvreté, insécurité et crise de confiance

Madagascar est encore dans  un état de pauvreté absolue. Et ce ne sont pas les actions de communication réalisées à travers les supports de communications (journaux, télévisions, réseaux sociaux) inféodés  au HVM qui pourront démontrer  le contraire.

Pauvreté, insécurité et crise de confiance

Chaque jour que Dieu fait, on assiste à cette paupérisation constante de la population malgache. A cela s’ajoute cette insécurité grandissante aussi bien en ville que dans les campagnes, ou encore sur les routes nationales, où les bandits de grand chemin détroussent les passagers des transports en commun. Et tout cela, dans une quasi-impunité puisque faute de moyens humains, matériels et financiers suffisants  et malgré leur volonté, les forces de l’ordre ne peuvent pas faire grand-chose. Les bailleurs de fonds font,  chaque fois que l’occasion se présente, des efforts pour aider le pays à mettre fin à  cette situation générale de  pauvreté et d’insécurité. Lors de la présentation, hier du nouveau cadre de partenariat pays de la Banque mondiale, il a été, d’ailleurs, de nouveau question de la nécessité absolue de renforcer la résilience des populations et de promouvoir une croissance inclusive afin de permettre une avancée nette dans la lutte contre la pauvreté. Les bailleurs de fonds sont prêts et s’activent pour sortir Madagascar de cette pauvreté.   Ils estiment  que pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, qu’elles soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises. L’une des conditions pour parvenir à ces objectifs de retour à la croissance est la mise en place d’une gouvernance administrative, économique et politique, soutenue par des institutions nationales et locales fortes. Mais la question qui se pose est de savoir si les dirigeants actuels fournissent effectivement des efforts pour y arriver. Car au point où on en est actuellement, la grande majorité de la population n’a plus confiance en ce régime qui n’arrive pas à la sortir du marasme socioéconomique. Une crise de confiance sans précédent.

R.Edmond.

Midi Madagasikara0 partages

Pauvreté, insécurité et crise de confiance

Madagascar est encore dans  un état de pauvreté absolue. Et ce ne sont pas les actions de communication réalisées à travers les supports de communications (journaux, télévisions, réseaux sociaux) inféodés  au HVM qui pourront démontrer  le contraire.

Pauvreté, insécurité et crise de confiance

Chaque jour que Dieu fait, on assiste à cette paupérisation constante de la population malgache. A cela s’ajoute cette insécurité grandissante aussi bien en ville que dans les campagnes, ou encore sur les routes nationales, où les bandits de grand chemin détroussent les passagers des transports en commun. Et tout cela, dans une quasi-impunité puisque faute de moyens humains, matériels et financiers suffisants  et malgré leur volonté, les forces de l’ordre ne peuvent pas faire grand-chose. Les bailleurs de fonds font,  chaque fois que l’occasion se présente, des efforts pour aider le pays à mettre fin à  cette situation générale de  pauvreté et d’insécurité. Lors de la présentation, hier du nouveau cadre de partenariat pays de la Banque mondiale, il a été, d’ailleurs, de nouveau question de la nécessité absolue de renforcer la résilience des populations et de promouvoir une croissance inclusive afin de permettre une avancée nette dans la lutte contre la pauvreté. Les bailleurs de fonds sont prêts et s’activent pour sortir Madagascar de cette pauvreté.   Ils estiment  que pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, qu’elles soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises. L’une des conditions pour parvenir à ces objectifs de retour à la croissance est la mise en place d’une gouvernance administrative, économique et politique, soutenue par des institutions nationales et locales fortes. Mais la question qui se pose est de savoir si les dirigeants actuels fournissent effectivement des efforts pour y arriver. Car au point où on en est actuellement, la grande majorité de la population n’a plus confiance en ce régime qui n’arrive pas à la sortir du marasme socioéconomique. Une crise de confiance sans précédent.

R.Edmond.

Midi Madagasikara0 partages

Antsenavolo-Mananjary: Enin-dahy nanafika mpivarotra

Jiolahy miisa enina mirongo fitaovam-piadiana no nanafika Ramatoa mpivarotra mipetraka ao amin’ny fokontany Ambodiara, kaominina Antsenavolo, distrikan’i Manajary ny 25 jolay lasa teo. Norobain’ireo mpanafika tamin’izany ny vovoka volamena 06 grama sy vola 500 000 ariary ary entam-barotra maromaro. Tsy vitan’izany fa lehilahy 44 taona sendra nifanena tamin’ireo jiolahy no niharan’ny vono sy ratra nataon’ireo olon-dratsy ireo nandritra io fanafihana io. Nanao ny fanarahan-dia avy hatrany ny zandary rehefa naharay izany vaovao izany saingy tsy mbola nisy tratra ireo nahavanon-doza.

T.M.

Midi Madagasikara0 partages

Pauvreté, insécurité et crise de confiance

Madagascar est encore dans  un état de pauvreté absolue. Et ce ne sont pas les actions de communication réalisées à travers les supports de communications (journaux, télévisions, réseaux sociaux) inféodés  au HVM qui pourront démontrer  le contraire.

Pauvreté, insécurité et crise de confiance

Chaque jour que Dieu fait, on assiste à cette paupérisation constante de la population malgache. A cela s’ajoute cette insécurité grandissante aussi bien en ville que dans les campagnes, ou encore sur les routes nationales, où les bandits de grand chemin détroussent les passagers des transports en commun. Et tout cela, dans une quasi-impunité puisque faute de moyens humains, matériels et financiers suffisants  et malgré leur volonté, les forces de l’ordre ne peuvent pas faire grand-chose. Les bailleurs de fonds font,  chaque fois que l’occasion se présente, des efforts pour aider le pays à mettre fin à  cette situation générale de  pauvreté et d’insécurité. Lors de la présentation, hier du nouveau cadre de partenariat pays de la Banque mondiale, il a été, d’ailleurs, de nouveau question de la nécessité absolue de renforcer la résilience des populations et de promouvoir une croissance inclusive afin de permettre une avancée nette dans la lutte contre la pauvreté. Les bailleurs de fonds sont prêts et s’activent pour sortir Madagascar de cette pauvreté.   Ils estiment  que pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, qu’elles soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises. L’une des conditions pour parvenir à ces objectifs de retour à la croissance est la mise en place d’une gouvernance administrative, économique et politique, soutenue par des institutions nationales et locales fortes. Mais la question qui se pose est de savoir si les dirigeants actuels fournissent effectivement des efforts pour y arriver. Car au point où on en est actuellement, la grande majorité de la population n’a plus confiance en ce régime qui n’arrive pas à la sortir du marasme socioéconomique. Une crise de confiance sans précédent.

R.Edmond.

Midi Madagasikara0 partages

Pauvreté, insécurité et crise de confiance

Madagascar est encore dans  un état de pauvreté absolue. Et ce ne sont pas les actions de communication réalisées à travers les supports de communications (journaux, télévisions, réseaux sociaux) inféodés  au HVM qui pourront démontrer  le contraire.

Pauvreté, insécurité et crise de confiance

Chaque jour que Dieu fait, on assiste à cette paupérisation constante de la population malgache. A cela s’ajoute cette insécurité grandissante aussi bien en ville que dans les campagnes, ou encore sur les routes nationales, où les bandits de grand chemin détroussent les passagers des transports en commun. Et tout cela, dans une quasi-impunité puisque faute de moyens humains, matériels et financiers suffisants  et malgré leur volonté, les forces de l’ordre ne peuvent pas faire grand-chose. Les bailleurs de fonds font,  chaque fois que l’occasion se présente, des efforts pour aider le pays à mettre fin à  cette situation générale de  pauvreté et d’insécurité. Lors de la présentation, hier du nouveau cadre de partenariat pays de la Banque mondiale, il a été, d’ailleurs, de nouveau question de la nécessité absolue de renforcer la résilience des populations et de promouvoir une croissance inclusive afin de permettre une avancée nette dans la lutte contre la pauvreté. Les bailleurs de fonds sont prêts et s’activent pour sortir Madagascar de cette pauvreté.   Ils estiment  que pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, qu’elles soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises. L’une des conditions pour parvenir à ces objectifs de retour à la croissance est la mise en place d’une gouvernance administrative, économique et politique, soutenue par des institutions nationales et locales fortes. Mais la question qui se pose est de savoir si les dirigeants actuels fournissent effectivement des efforts pour y arriver. Car au point où on en est actuellement, la grande majorité de la population n’a plus confiance en ce régime qui n’arrive pas à la sortir du marasme socioéconomique. Une crise de confiance sans précédent.

R.Edmond.

Midi Madagasikara0 partages

Pauvreté, insécurité et crise de confiance

Madagascar est encore dans  un état de pauvreté absolue. Et ce ne sont pas les actions de communication réalisées à travers les supports de communications (journaux, télévisions, réseaux sociaux) inféodés  au HVM qui pourront démontrer  le contraire.

Pauvreté, insécurité et crise de confiance

Chaque jour que Dieu fait, on assiste à cette paupérisation constante de la population malgache. A cela s’ajoute cette insécurité grandissante aussi bien en ville que dans les campagnes, ou encore sur les routes nationales, où les bandits de grand chemin détroussent les passagers des transports en commun. Et tout cela, dans une quasi-impunité puisque faute de moyens humains, matériels et financiers suffisants  et malgré leur volonté, les forces de l’ordre ne peuvent pas faire grand-chose. Les bailleurs de fonds font,  chaque fois que l’occasion se présente, des efforts pour aider le pays à mettre fin à  cette situation générale de  pauvreté et d’insécurité. Lors de la présentation, hier du nouveau cadre de partenariat pays de la Banque mondiale, il a été, d’ailleurs, de nouveau question de la nécessité absolue de renforcer la résilience des populations et de promouvoir une croissance inclusive afin de permettre une avancée nette dans la lutte contre la pauvreté. Les bailleurs de fonds sont prêts et s’activent pour sortir Madagascar de cette pauvreté.   Ils estiment  que pour avoir une croissance inclusive et durable, il faut avant tout veiller à ce que les populations aient un bon départ dans la vie dès leur plus jeune âge, qu’elles soient plus productives grâce à des investissements en infrastructures, un meilleur accès à la finance et un meilleur climat des affaires pour les petites et moyennes entreprises. L’une des conditions pour parvenir à ces objectifs de retour à la croissance est la mise en place d’une gouvernance administrative, économique et politique, soutenue par des institutions nationales et locales fortes. Mais la question qui se pose est de savoir si les dirigeants actuels fournissent effectivement des efforts pour y arriver. Car au point où on en est actuellement, la grande majorité de la population n’a plus confiance en ce régime qui n’arrive pas à la sortir du marasme socioéconomique. Une crise de confiance sans précédent.

R.Edmond.

Madagate0 partages

Madagascar. Une ambiance de méfiance règne à tous les niveaux de la société malgache

Groupe des Experts Nationaux (GEN)

Rue Rajakoba Augustin Ankadivato Antananarivo

E-mail : Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

Tél : 22 663 99 Fax : 22 663 59

-------------------

N/Réf. GEN.220.07.17/MR/rh

LES ÉLECTIONSVECTEUR ET CATALYSEURDECONFLITS ET DE CRISES POLITIQUES PERSPECTIVESDE LA PREVENTION

A-ANALYSEDE LACRISE

Les élections en 2018, dans le calme, la paix où les belligérants acceptent les résultats, c’est le souhait de tous les Malagasy.

La situation actuelle est alarmante et les risques de conflits sont bien réels. Dans une perspective de prévention, le GEN propose une réflexion approfondie afin de contourner, d’éliminer ou tout au moins d’atténuer toute source de tension liée au processus électoral.

La méfiance règne au sein de notre société :

- Méfiance vis-à-vis des autorités politiques qui n’engagent pas le pays dans une stabilité démocratique dans la mesure où l’aspiration à un second mandat y règne encore ;

- Méfiance vis-à-vis de l’appareil judiciaire quine démontre pas son indépendance et son impartialité, ce qui explique pourquoi la vindicte populaire fait tâche d’huile dans le pays ; la sécurité est dans un état incontrôlable et se manifeste par l’autodéfensevillageoise ;

-Méfiance vis-à-vis des nantis du pouvoir qui tirent les ficelles pour accaparer les marchés publics et exploiter les ressources naturelles ;

-Méfiance vis-à-vis des forces de l’ordre qui faillissent à leur engagement de protéger les personnes et leurs biens.

-Méfiance vis-à-vis de la Haute Cour Constitutionnelle (HCC) dont les avis et décisions actuelssont suspectés de partialité ;

-Méfiance vis-à-vis de la Commission Électorale Nationale Indépendante (CENI)qui manque d’impartialité parce que dépendante du régime et de la Communauté internationale ;

-Méfiance vis-à-vis des partis politiques qui ne s’unissent que pourrenverser le régime en dérive et restent atomisés lors de la quête du pouvoir ;

-Méfiance vis-à-vis d’une frange de la Communauté Internationale qui prend le citoyen Malagasy pour des mineurs, établit et décide comme des tuteurs et parfois impose la route à suivre dans la conduite des affaires nationales (feuillede route) ;

En effet, le terrain est actuellement miné, sur le plan politique, économique, social et environnemental et l’explosion peut intervenir à tout moment ;

Pour réaliser des élections dont les résultats seraient acceptés sans discussion, il nous faut, à nous Malagasy, identifier les causes profondes des problèmes et les résoudre par nous-mêmes, par la concertation et le dialogue.

B-ANALYSE DES ACTEURSET DE LEURS INTÉRÊTS

La réflexion part des constats de ce que le pays a vécu durant les quarante dernières années (1975-2015).

-Le parti au pouvoir monopolise et verrouille l’appareil étatique, prend des décisions unilatérales, pour l’opérationnalisation des institutions en charge de l’organisation des élections, ceci afin de rester au pouvoir éternellement, par crainte devengeance et de représailles s’il y aalternance.

Et toute forme d’opposition est écartée voire réprimée.

-Le parti opposant au régime, convaincu de vaincre aux élections, face à la situation dans le pays, est exclu des prises de décision et n’est pas représenté dans l’organeorganisateur des élections. Une contestation des résultats et du processus mêmeest probable, source de tension politique grave (2002).

-Le citoyen électeur, source de la démocratie, souffre de la pauvreté et de l’inflation, est déconnecté de la vie nationale et n’est point consulté dans les décisions politiques. Cette exclusion par le pouvoir aura un effet boomerangviolent, selon les circonstances.

-La HCC, appareil judiciaire dontle jugement est définitif, non susceptible de recours, assure un rôle important dans la prévention de la crise, comme ce fut le cas du jugement prononcé à Mantasoa en décembre 2001.

Le risque majeur est l’instrumentalisation de la HCC sur la proclamation de la victoireet la non considération des recours aux contentieux électoraux des candidats adverses.

Mais actuellement, on assiste à une crise de confiance vis-à-vis de cette institution : Déchéance du PRM - Nomination du PM - Mandat impératif des députés - Chef de l’opposition………

-La composition de la CENI, organe de gestion des élections, fait l’objet de remarques pertinentes quant à son indépendance et son impartialité, le parti se disant de l’opposition n’étant pas représenté dans cet organe etcertains desmembres actuels ayant déjà occupé des postespolitiques au sein du gouvernement ou des membres de parti pro régime.

La loi n°2011–013 du 9 septembre 2011 portant statut de l’opposition et des partis d’opposition est claire. L’opposition est dirigée par un Chef de l’opposition officiel.

Le rôle de la société civile est déterminant dans la restauration de la paix et de la démocratie pour un développement de tout homme et tout l’homme. Actuellement, on assiste àdes actions dispersées et inefficaces face à la situation alarmante du pays. Les OSCsont des partenaires importants et indispensables à la réflexion pour éviter le chaos électoral.

-L’église a joué dans le passé un rôle de rassembleur et de défenseur des opprimés pour qu’il y ait veritédans le jeu démocratique et le respect des droits humains.

Elle est consciente de l’impact négatif de manifestations désastreuses comme ce fut le cas à Antsakabary – Befandriana Nord. Pourquoi ne pourrait-elle pas continuer à jouer ce rôle d’interpellation ?

- Au niveau de la Communauté Internationale : une crise post électorale est prévisible, mais une réaction timide de la C.I sur les imperfections et les soucis sur le devenir du pays nationaux restent à déplorer.

En d’autres termes, une véritable ingérence a été annoncée et imposée (feuille de route, sanctions internationales). La souveraineté nationale reste bafouée.

C-RECOMMANDATIONS STRATÉGIQUES

En définitive, la récurrence des instabilités entrainées par les élections est un indicateur pour opérer, dans l’urgence, des réformes juridiques et institutionnelles.

Réformes des textes régissant le Code Électoral, la CENI, la HCC.

Dans cette optique, le GEN recommande des ASSISES NATIONALES, qui ne sont pas imposées par la Communauté Internationale, mais négociées par tous les acteurs politiques, les Organisations de la Société Civile, les syndicats, etc.

Le GEN est disposé à être le leader de ces Assises, si les parties prenantes donnent leur accord.

Profitons de nos expériences du passé, pour réconcilier la nation avec elle-même, pour établir des réformes dans un consensus afin d’amoindrir lescontestations.

Antananarivo, le 21 juillet 2017

Madeleine Ramaholimihaso, Bruno Rakotoarison, Charles Rakotonirina, Cocken Razafiarison, Hasina Rakotoson, Zafimandimby

**************************

Groupe des Experts Nationaux (GEN)

Rue Rajakoba Augustin Ankadivato Antananarivo

E-mail : Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

Tél : 22 663 99 Fax : 22 663 59

-------------------

N/Réf. GEN.220.07.17/MR/rh

Vaha olana ve ny fifidianana ao anatin’ny tsy fifampitokisana sy ny krizy politika?

Ahoana no hisorohana an’izany?

A-FANADIHADIANA

Nyfifidianana atao dia entina hamaritoerana ny fitondrana lany ara-dalana sy ara-drariny, ary eken’ny mpifanandrina ny vokatra ao anatin’ny fitoniana sy filaminana.

Ekena araka izany ny tsy fiandanian’ny mpikarakara sy ny andrimpajankana mamoaka ny vokatra ofisialy.

Raha ny zava misy ankehitriny no alalinina dia tsy azo hidovirana ny tsy fanekena ny vokatra ary hiteraka korontana sy fisavoritahana mahery vaika.

Inona ny antony ?

Tsy misy intsony ny fifampitokisana:

-Eo amin’ny mpitondra sy ny vahoakaentina, manana ny fahefana, tsy mitondra mankany amin’ny fitoniana demokratika, manidy ny rafi-pahefana rehetra, mampiasa ny fahefampanjakana, ary mikatsaka ny ho lany hatrany amin’ny fifidianana ho avy.

-Tsy matoky ny rafi-pitsarana, tsy hita taratra ny fahaleovantenany sy ny fiarovana ny marina. Ny faniriana amin’ny valimpifidianana ho avydia tena vokatra tsy hisy hosoka.

Maneho izany ankehiriny ny fitsarambahoaka mahazo laka izay midika fametrahana fiarovan-tena eo anivon’ny fiarahamonina.

-Tsy matoky ireo olona akaiky ny fitondrana, tsy maty manota, manapatra fahefana ny vahoaka, izany dia azo tarafina amin’ny fananana harena tsy mari potitra etsy sy eroa.

-Tsyfitokisana ny mpitandro ny filaminana, ny tarigetra ho fiarovana ny vahoaka toa tsy hita fa lasa mpiaro ny mpitondramangeja ny fahefana, vokatr’izanysahirantsaina ny mponina fa raha hiteny dia daroka sy fisamborana no setriny (Soamahamanina).

-Tsy fahatokisana ny HCC, manoloana ireo didy sy fanapahana noraisiny, miteraka ahiahy ny vokatra izay havoakany amin’ny fifidianana.

-Tsy matoky ny Ceni, rafitra miankidoha tanteraka amin’ny vondrona iraisampirenena, miankidoha amin’ny Fanjakàna ara-bola ary ny fahitana ireo mpikambana nitàna toerana ambony teo aminy sehatra politika.

-Tsy fahatokisana ireoantoko politika, mivondrona rehefa hanongana ny fitondrana, ary ny fizarana ny seza no mahamaika azy ireo.

-Tsy mahatoky ny ampahany amin’ireo vondrona iraisampirenena ,izay mihevitra ny Malagasy ho zaza, koa mila tatanana sy baikona amin’ireo lalana tokony alehany hitondrana ny raharaha-pirenena (feuille de route).

Izany hoe ankehitriny, fiarahamonina hanjakan’ny tsy fifampitokisana no misy eto ary pitik’afo kely dia mety hampipoaka ny vanja, ary an’isany izany io fifidianana kasaina ho tanterahina io.

Ny GEN dia mandala ny demokrasia, manaiky ny tokony hanaperan’ny olomboafidy ankehitriny ny fe-potoana iasany, saingytokony jerena miaraka ny olana sy ny fototr’ireo tsy fifampitokisana ireo, ary hirosoana amin’ny vaha olana hitambarana.

B-IREO MPISEHATRA SY NY TOMBOTSOANY

-Ny fandalinana sy fanadihadiana ireo zava misy niainan’ny firenena nadritra ny taona 1975-2015 no nahafahana nampisongadina ireto toe-javatra ireto :

Misy hetaheta miverimberina takian-DraMalagasy toy ny hoe tanindrazana tsy azo hamidy-ny ara tsosialy, ny fahaizana mihaino, ny fijerevana ireo vondron’olona ifotony, ny fanaparapahefana, ady amin’ny fahantrana, ny fahaizana mitsinjo lavitra ….

Ny antoko politika tonga eo amin’ny fitondrana dia manidy varavarana, manao salobokomana, manapakevitra tsy hifampizarana, mandrafitra ny fikarakarana ny fifidianana mba ho lany hatrany ary ny fitarainana sy ny fitoriana dia lazaina fa tsy maripotitra sy tsy tomombana (vice de forme).Ny antony dia tahotra ny valifaty sy fanagadrana raha sanatria tsy lany.

Ny vondrona iraisampirenena dia mikatsaka ny olona hiaro ny tombotsoany, mampitrosa sy miaro raha misy korontana sy manome toky ireo mpanao politika fa hanohana azy fa anjarany ny mandamina ny ao anatiny ( fampiharana sazy iraisampirenena, tsy fahazoana manitsaka ny tanin’izy ireo na fampiakarana ny raharaha eo anivon’ny Cours Pénale Internationale (CPI)).

Ny olompirenena mpifidy, miaina ao anaty fahantrana lalina, voahilika amin’ny fanapahankevitra dia mihevitra ny tenany ho Malagasy tsy misy mpihahy ary miavotena irery, ny fanomezana sisa andrasana, izay hararaotin’ny mpilatsaka ho fidiana hampandriana adrisa fotsiny ihany ; ireo olona ireo dia mora entina ao anatin’ny savorovoro, tsy voafehy intsony, ho lozaho an’ny firahamonina, satria eo no heveriny fa fotoana hilazan’ny tsy fankasitrahany fitondràna.

Ny antoko politika mitonona ho mpanohitra, izay tsy voasolotena ao antin’ny Ceni dia, mametraka ireo paipak’ady rehetra, hilazanafa tsy misy tomombana ny fikarakarana fa voabaikon’ireo mpanohana azy ny rafitra Ceni, tsy misy fahaleovantena, sahalan’ny nahazo ny Ministeran’ny ati-tany izay niafara tamin’nyfitsipahana tanteraka ny vokatra vonjimaika navoakany tamin’ny fotoana androny.

Ny Fiangonana dia nanana anjara lehibe tamin’ny fandaminanaho fiarovana ny marina sy ny rariny, mijoro ho mpampihavana, saingy ankehitriny tsy hita taratra intsony izany . Iza no antsoinasy hitarainana raha misy marary? TSY misy intsony fa dia samy miaro ny tenany ny tsirairay.

C-SOSO-KEVITRA

Rehefa fakafakaina ireo rehetra ireo dia tsy ho mari-toerana ny fitondrana aorian’ny fifidianana ; ilaina araka izany ny handinihana haingana ny lalàna sy ny rafitra rehetra manodidina ny fifidianana ho eken’ny rehetra.

Mitsambiky mikipy isika raha terena hakatoa ny mpandresy amin’ny fifidianana izay lazaina fa lany demokratika.

Manolona izany dia manainga ny rehetra mahatsapa fa teratany Malagasy ny GEN, hifandinika sy hiara hamaritraao anatiny Fikaonan-doham-pirenena “Assises nationales” nylalana hizorana, izany dia manaja ny fahataperan’ny fe-potoana hiasan’ny olomboafidy rehetra lany ankehitriny.

Vonona ny GEN hitarika sy handrafitra ny fomba fiasa raha eken’ny maro izany fotokevitra izany.

Antsika rehetra i Madagasikara koa isika ihany no afaka hifandamina tsy hisian’ny korontana eto amin’ity firenena ity. Efa hita sy niainana teto fa tsy vaha olana ny fampiasankery sy fahefana hamoritra (Avril 1971-Mai 1972-10 Août 1991- 2002- 7 Février 2009…), ny fidirana amin’izany dia nandetikasy namotika ny fiarahamonina sy ny kolontsaina Malagasy.

Antananarivo, faha-21 jolay 2017

Madeleine Ramaholimihaso, Bruno Rakotoarison, Charles Rakotonirina, Cocken Razafiarison, Hasina Rakotoson, Zafimandimby