Les actualités Malgaches du Jeudi 21 Juin 2018

Modifier la date
News Mada183 partages

Insécurité : quatre taxis-brousse attaqués à Maevatanàna

La sécurité le long de la RN4 et la RN6 n’est plus assurée. Les usagers de ces routes, particulièrement les taxis-brousse sont les principales cibles des coupeurs de route.

Avant-hier, aux environs de 23 heures, des taxis-brousse en direction de Mahajanga et d’Antsiranana ont été attaqués, à quelques kilomètres après Maevatanàna. Composée de quatre véhicules, la caravane s’apprêtait à passer un casseur de vitesse quand sa course avait été interrompue par un barrage. Les bandits avaient installé des blocs de pierre et des troncs d’arbre sur la route. Réalisant qu’il s’agissait d’une attaque, les automobilistes ont tenté de passer  par l’accotement mais plusieurs individus armés ont surgi de nulle part. Les bandits ont blessé trois chauffeurs. «Un des conducteurs a été frappé avec une machette à la main tandis que les deux autres ont reçu des coups sur la tête», selon le représentant des conducteurs de taxi-brousse qui opèrent sur la RN4 et la RN6. «Des passagers ont également été agressés. D’ailleurs, les assaillants ont tiré une fois sur un des taxis-brousse mais heureusement, personne n’a été touché», a-t-il indiqué. Les voleurs ont dérobé les objets des passagers dont l’argent, les téléphones, les bijoux…

Les conducteurs haussent le ton

Face à cette situation alarmante, les chauffeurs de taxi-brousse qui opèrent sur ces deux axes routiers ont lancé un appel de détresse aux autorités pour voir de près la situation. Ils exigent particulièrement l’enlèvement au plus vite des casseurs de vitesse, surélevés, placés sur les routes qui ne présentent pas trop de risques d’accident car ils ne font que faciliter les forfaits des bandits. Ils lancent  un ultimatum de 72 heures pour que les autorités compétentes prennent des mesures rigoureuses pour mettre fin à l’insécurité sur les routes.

Ando Tsiresy

 

News Mada27 partages

« Une question de volonté politique », selon le MMM

Alors que les déclarations politiques se succèdent, la date des élections n’est toujours pas dévoilée malgré la décision de la Haute cour constitutionnelle (HCC) pour la tenue d’une élection anticipée. Si, d’une part, les partisans du régime ne sont pas d’accord, le reste n’y voit aucun inconvénient, à l’instar du parti Malagasy miara-miainga (MMM). «Il suffit d’un peu de volonté de la part de la HCC pour que ces élections aient lieu», a fait savoir le leader du parti, Hajo Andrianainarivelo, hier à Ankerana, lors d’une rencontre avec la presse. Il explique ainsi que la Haute cour n’aura juste qu’à clarifier la situation en présentant sa décision.

Le MMM appelle ainsi la HCC à appliquer sa décision du 25 mai dernier pour pouvoir instaurer un climat d’apaisement dans le pays. «La HCC a créé le conflit, il lui appartient de le régler», a souligné Hajo Andrianainarivelo. Le MMM attend ainsi la réponse de la HCC face à la requête déposée par le parti récemment, sur l’interprétation de sa décision n°18-HCC/D3 du 25 mai 2018, notamment la clé de répartition des ministères.

T.N

Midi Madagasikara19 partages

La sécurité et les infrastructures, facteurs déterminants Développement du Tourisme

Passation sur terrain hier entre le ministre du Tourisme sortant Roland Ratsiraka et son successeur Brunelle Razafitsiandraofa

Même s’il n’est plus le ministre de tutelle, Roland Ratsiraka a tenu à honorer jusqu’au bout ses engagements avec la conférence de haut niveau sur le thème : « Comment le tourisme seul pourrait développer Madagascar ? » qui s’est tenue hier au Carlton. 

Tous les acteurs du secteur du tourisme étaient réunis hier au Carlton Anosy, dans le cadre de l’atelier organisé sous le thème « Comment le tourisme seul pourrait développer Madagascar ?». Selon les participants, la  sécurité et les infrastructures sont des facteurs déterminants  pour répondre à cette question. « Avec les opportunités et les richesses naturelles de ce pays, le tourisme peut quadrupler à lui seul la croissance économique de Madagascar. Mais pour cela, il faut anticiper la venue des touristes et faire en sorte qu’ils aient envie de venir dans la Grande Ile. Il y a déjà un « cluster » avec nous qui veut développer le circuit VIP. Des discussions avec les chaînes de renommée internationale sont déjà en cours pour la construction d’hôtel 5 étoiles. L’objectif est de transformer ce pays en paradis touristique », a affirmé Tiana Rasamimanana, « chief of staff » du Groupe Sipromad qui a appuyé l’organisation de cet atelier initié par l’ancien ministre du Tourisme, Roland Ratsiraka qui a tenu à honorer jusqu’au bout ses engagements à travers cette conférence. L’occasion pour le ministre sortant de faire en quelque sorte, une passation sur terrain au ministre entrant,  Brunelle Razafitsiandraofa. Lequel a indiqué que plusieurs plaintes ont déjà été émises par le secteur privé, notamment sur la corruption, les rackets, l’insécurité, ou encore les problèmes d’accès à l’énergie et le manque d’infrastructures, etc. D’après ses dires, les résolutions de cet atelier seront étudiées et appliquées par la suite pour résoudre les problèmes de développement du secteur du tourisme à Madagascar.

Importance. Près de 500 participants ont assisté à l’atelier d’hier. La gouvernance et la sécurité, les défis de la promotion de la destination Madagascar et les investissements dans le tourisme et enfin les infrastructures et les transports constituaient les grandes thématiques discutées durant la rencontre. Tous les participants ont soutenu l’importance du rôle du tourisme dans l’économie malgache. « Si l’on considère que les petits pêcheurs et les petits agriculteurs des zones côtières peuvent nourrir leur famille, grâce à un touriste qui vient à Antananarivo pour manger, on se rend compte de la dimension de ce secteur d’activité, ainsi que des impacts de son développement. L’Etat doit impérativement assurer son rôle dans la sécurité publique, les infrastructures et l’énergie, etc. », a noté John Place, représentant du secteur privé. Même les représentants des partenaires techniques et financiers ont appuyé cette version. Le chargé d’Affaires de l’Ambassade des Etats-Unis a indiqué que le développement du tourisme est prioritaire. D’après lui, c’est pour cela que cette grande puissance appuie la protection du capital naturel, la conservation de l’écosystème et du patrimoine culturel à Madagascar, etc. Pour l’heure, le tourisme représente 7% du Produit intérieur brut de Madagascar, soit beaucoup plus que les mines. Et pourtant ses opportunités de développement sont encore énormes.

Antsa R.

News Mada11 partages

« M’Kolosaina 2.0 » : haha matihanina ny asa momba ny kolontsaina

Ho matihanina kokoa ireo karazan’asa mahakasika ny kolontsaina. Io ny tanjon’ny ADMC-Craam ao anatin’ny tetikasa “M’Kolosaina 2.0”, tohanan-dry zareo Norvezianina. Tamin’ny fotoana niorenan’ny fikambanana, efa nahatsapa izy ireo fa mila olona matihanina ireo sehatr’asa ireo raha tiana ny hampivoatra ny kolontsaina eto amintsika.

Ho fanatrarana izany, anisan’ny sahaniny ny fanofanana sy ny fizarana asa mikasika ireo asa momba ny kolontsaina, ny fanomezan-danja ny mpanakanot sy ireo mpanetsiketsika ny kolontsaina ary ny fampiroboroboana ny fampiasam-bola eo amin’ny sehatry ny kolontsaina.

Mifampitohy amin’izany rehetra izany ny “M’Kolosaina 2.0”, izay vao nampahafantarina ny talata lasa teo.  Maromaro ny tetikasa hotanterahina ao anatin’izany. Singanina amin’izany, ohatra, ny hanatontosana « salon » momba ireo asa mahakasika ny kolontsaina ka tanjona ny hampahafantatra izany amin’ny tanora mpianatra. Miisa 10 ity « salon » ity.

Ao anatin’ny asa ihany koa ny hanatanteraka fiofanana manokana ho an’ireo efa miasa eo amin’ny sehatry ny kolontsaina sy ny zavakanto. Ho maromaro ny lohahevitra hiompanan’izany fiofanana izany. Hanampy izany ny famoahana « catalogue » na lasitra ahitana ireo karazana asa misokatra mikasika ny kanto sy ny kolontsaina hatrany. Eo koa ny fanohanana ny mpanakanto, amin’ny alalan’ny fampahafantarana azy ireo sy ny sanganasany.

Landy R.

 

Midi Madagasikara11 partages

Fête de la musique à Toliara : Trois concerts en plein air

Le Sud à l’honneur, 21 artistes pour fêter la Musique le 21 juin.

Le Sud à l’honneur. 21 artistes ayant en commun l’héritage des traditions musicales du Sud de Madagascar. Au cœur de l’initiative, « ATSI-MOZIKA », un projet visant à stimuler le renouveau du terroir artistique du Sud, entre tradition et modernité. Il est soutenu par un Fonds commun multi-bailleurs et Orange Madagascar. Il a donné naissance à « la Résidence Musicale », atelier animé par sept intervenants professionnels, dont Miangaly et  Rolf, déjà reconnus. Grâce à l’échange de compétences, les artistes ont pu apprendre et approfondir toutes les techniques vocales et instrumentales. En même temps ils ont pu travailler la présence scénique, la rythmique et l’écriture. Cette rencontre a aussi amené, ces musiciens, à fusionner les musiques traditionnelles aux formes plus contemporaines et programmer un répertoire digne de choix et satisfaire le public de la  Cité du Soleil pour le 21 juin, Fête de la Musique, le tout orchestré par Ivanne Girard, directrice de l’Alliance Française de Tuléar.

Charles RAZA, correspondant

News Mada10 partages

Kianjan’ny 13 mey : 11 sisa ireo depiote…

Tsy mijanona ny tolona raha tsy miala ny minisitra HVM  eo anivon’ny governemanta.  Mpamadika ireo tsy  tonga  eto  intsony satria nifanao velirano isika sy ny vahoaka”, hoy  ny mpitondra teny  teny amin’ny kianjan’ny 13  mey, omaly. Depiote 11 amin’ireo   73  sisa teny an-toerana. Nanteriny fa nahagaga azy ireo  izao fisintahan’ny  sasany eny an-kianja izao. Tsy azo ianteherana fa namadika  sy manary an-dalana izy ireo, araka ny nambarany ihany.   “Mahatsiaro izany isika ary niaraha-naheno  teto ny lahateny rehetra momba izany”, hoy  ihany izy.

Etsy andaniny, ho  feno roa volana ny hetsika eny amin’ny kianjan’ny 13 mey. Hanao  fanambarana lehibe ny  depiote hany mbola  mijoro  ny faran’ny  herinandro izao.

Randria

 

News Mada7 partages

Université de Mahajanga : les étudiants entrent de nouveau en grève

Comme il fallait s’y attendre, l’affaire relative à la distribution des logements universitaires, qui viennent d’être réhabilités, n’a pas manqué de créer une autre source de trouble au sein de l’université de Mahajanga.

Les étudiants veulent dicter leur loi. N’ayant pas pu imposer leurs conditions sur le mode d’attribution des cités universitaires, ces derniers sont entrés en grève, hier, après l’ultimatum de 48 heures qu’ils ont lancé lundi.  Comme à chacun de leurs manifestations, les grévistes ont bloqué l’entrée  au Campus d’Ambondrona, tout en brûlant des pneus sur la chaussée. Les éléments des forces de l’ordre, dépêchés sur les lieux, étaient prêts à intervenir en cas de débordement.

Le mouvement a pour objectif de faire pression sur les responsables pour qu’ils reviennent sur leur décision relative à la distribution et la gestion des cités universitaires, qui sont prêtes à accueillir les bénéficiaires après les réhabilitations entamées l’an dernier.  Ils protestent également contre le fait que les quelque 1.023 demandeurs de logements ne soient pas tous inscrits dans la liste des bénéficiaires, contrairement à l’annonce faite la semaine dernière par le président de l’Université. En fait, en vue de mettre fin aux gabegies qui régnaient dans le secteur, les responsables ont décidé de retirer la gérance de ces infrastructures aux associations régionales des étudiants, comme  c’était le cas depuis des années.

Une disposition que les étudiants n’ont pas digérée puisqu’ils n’ont désormais plus la possibilité d’interférer dans la distribution des logements, qui sont la propriété de l’université. «L’objectif, c’est également d’opérer une distribution partiale de ces biens publics, qui devront être accessibles à tous les étudiants  remplissant les critères d’attribution, mais pas seulement aux membres des associations régionales, qui ont d’autres alternatives pour se loger ailleurs, durant les cursus à l’université», a fait entendre un responsable au sein de l’université de Mahajanga.

Codis…

 Les grévistes ont également soulevé, comme motif de leur mouvement, leur insatisfaction aux résultats du Conseil de discipline (Codis), auquel certains d’entre eux ont été soumis à la suite des derniers mouvements estudiantins, qui se sont soldés par la destruction de biens publics dans l’enceinte de l’université et dans la ville de Mahajanga. «Alors qu’à l’issue d’une reprise des enquêtes y afférentes, une bonne partie des étudiants concernés ont déjà obtenu un allègement de peine», d’après les informations.  Manifestement, les grévistes veulent imposer leur loi dans les affaires de l’université, en usant toujours de la force pour  protester contre les mesures de discipline en vigueur. Mais, la présidence de l’université ne se laisse pas faire également.

Fahranarison

News Mada5 partages

Élections anticipées : la date des scrutins à fixer

La tenue de la présidentielle anticipée, conformément à la décision de la HCC du 25 mai, est actuellement attendue. Le gouvernement et la Ceni devront trouver un terrain d’entente à ce propos.

Alors que la situation politique reste encore confuse, la sortie de la prochaine présidentielle pourra atténuer les tensions. A ce titre, des discussions sont actuellement en cours, la Commission électorale nationale indépendante (Ceni) est à pied d’œuvre pour la tenue des élections pour cette année. Une chose est sûre, «La Ceni proposera une date pour des élections anticipées», a indiqué le vice-président de l’organe, Philibert Hervé Rafenomanantsoa, joint au téléphone hier. Après la rencontre avec le gouvernement qui s’est tenue samedi dernier, la Ceni a également rencontré les responsables au sein du ministère de l’Intérieur et de la décentralisation, deux jours après, soit lundi dernier. Après mûres réflexions, «La Ceni a proposé une date entre la fin du mois d’octobre et le début du mois de novembre prochain», a fait savoir le rapporteur général de l’organe, Fano Rakotondrazaka, hier.

Proposition

Quoi qu’il en soit, trouver la date de la présidentielle ne devrait pas prendre du temps dans la mesure où la Ceni avait déjà proposé trois dates lors d’une rencontre avec la presse à Nanisana, le 8 mai dernier. La Ceni avait alors proposé la date du 29 août 2018 pour le premier tour de la présidentielle. Dans le premier cas, la Ceni propose des élections anticipées, selon les dispositions des articles 52 et 53 de la Constitution au cas où les acteurs politiques se décident pour une élection anticipée. Et ce, en dépit des contraintes techniques et matérielles pour son organisation. Dans cette optique, maintenant que la situation a évolué dans ce sens avec la mise en place d’un nouveau gouvernement, pourquoi un scrutin anticipé en octobre ne serait-il pas possible ?

La tenue de la présidentielle en octobre  pourra aussi, d’une part, aider à apaiser la tension politique car les manifestants sur la Place du 13 mai continuent de réclamer la démission du président de la République. La démission du Chef de l’Etat, 60 jours avant la date, contribuera ainsi à favoriser l’apaisement. Par la même occasion,  le délai de la convocation des électeurs qui, selon l’article 51 de la loi n°2018-008 relative au régime général des élections et référendums, est de «quatre-vingt-dix (90) jours au moins avant la date du scrutin par décret pris en Conseil de Gouvernement, après consultation du projet de calendrier électoral présenté par la Ceni», pourrait être respecté.

Sans oublier que la saison sèche arrive à terme en octobre alors que la HCC avait intimé la tenue de la présidentielle durant cette période. L’option des scrutins présidentiels en octobre favorisera ainsi, sur plusieurs fronts, à calmer les esprits dans un contexte de tension.

Rakoto

News Mada5 partages

Antsan-tononkalo : hanolotra ny « Anjankira » ny Sandratra

Mitohy hatrany ny fampivelarana sy fampahafantarana ny asan’ny mpanoratra ao anatin’ny Faribolana Sandratra. Poeta 4 mirahalahy indray no hanatanteraka ny « Anjankira »…

Tafiditra ao anatin’ny fankalazana ny « Iray volan’ny teny malagasy », hanatanteraka antsan-tononkalo ny poeta efatra mirahalahy ahitana an’i Narilala, i Zo Sitrakiniavo, i Rojo Fanahy, ary i Andriniela avy ao amin’ny Faribolana Sandratra. Seho miavaka, tontosaina etsy amin’ny Cercle Germano-Malagasy (CGM) tohatohabaton’Antaninarenina, ny 23 jona izao manomboka amin’ny 3 ora tolakandro. Antsan-tononkalo nampitondrain’izy ireo ny lohateny hoe « Anjankira ».

Raha ny fanazavan’i Narilala avy amin’ny teny roa « anja » sy « hira » ny niteraka ny « Anjankira ». Ny « Anja », ilazana ny hatsarana miafina ao anaty poezia. Ny « hira » indray ilazana ireo firindran-teny voakaly narahim-peo miavaka maha poezia ny poezia. “Izany hoe, seho entina hilazana ireo hatsarana maha poezia izay voizina eny an-tsehatra ny “Anjankira” “, hoy hatrany i Narilala.

Nambarany fa haseho ao ny poezia amin’ny endriny rehetra, toy ny fitiavan-tanindrazana, ny fitiavan’olon-droa, ny raharaham-pirenena ankehitriny sns…. Nomarihin’ireto poeta ireto fa ankoatra ny antsan-tononkalo, voarakitra anaty boky manana pejy 120 ihany koa ny “Anjankira”. Hisy boky azo jifain’ny mpanatrika rahateo eny an-toerana amin’io fotoana io. Tahaka ny nahazatra ny Faribolana Sandratra hatramin’izay, tsy hisy ny vidim-pidirana fa afaka manatrika ity fiantsana tononkalo ity avokoa izay rehetra liana amin’izany.

HaRy Razafindrakoto

 

Midi Madagasikara5 partages

Tsimbazaza : Trois ministres limogés récupèrent leurs « seza » de député

Les trois ex-ministres redevenus députés.

Le président de l’Assemblée nationale a saisi la HCC d’une demande de trois ministres limogés qui souhaitent récupérer leurs sièges de députés.

Selon l’Avis émis par la HCC le 16 février 2018, « le mandat de l’actuelle législature de l’Assemblée nationale se termine impérativement le 5 février 2019 à minuit ». En somme, il ne reste plus que 7 mois et 2 semaines de mandat pour les membres de la Chambre basse. La seconde session ordinaire de l’année qui commencera le 16 octobre prochain sera la dernière de la première législature de la Quatrième République.

Dépités. Tout cela n’a pas empêché les 3 ministres limogés Marie Lydia Toto Raharimalala, Johanita Ndahimananjara et Jean-Jacques Rabenirina de demander leur réintégration au sein de l’Assemblée nationale. Un appétit insatiable de « seza » qui fera des « dépités » dans les rangs de leurs suppléants respectifs dans les travées de l’Hémicycle, en l’occurrence, René Rakotonirina Andriamifalisoa, Samuelson Jean Baptiste Rasolofo et Ludovic Edmond Andriamarotia. Leur mandat (de substitution) a pris fin le mercredi 19 juin 2018 à 15 heures, à la date de l’arrêté de la HCC réintégrant ces ex-ministres à Tsimbazaza où l’on attend de voir leur assiduité.

Suspendus d’office. En revanche, les 4 députés nommés ministres dans le gouvernement Ntsay sont suspendus d’office de leur mandat. Il s’agit de Razafintsiandraofa Jean Brunel (Mapar) ; Naharimamy Lucien Irmah (Mapar) ; Randrianarisoa Guy Célin Rivoniaina (mouvance Ravalomanana) ; Rahantasoa Lydia Aimée Vololona (mouvance Ravalomanana) ; et Razanamahasoa Christine (Mapar). Ils cèdent leurs « seza » à leurs premiers suppléants respectifs, à savoir, Velotia ; Imbinina André ; Rasendramiadana Clarisse ; Rakotonjatovo Anto Arilafa ; et Rasolofo Andriamora Charming Blise. Nonobstant d’éventuelle(s) session(s) extraordinaires, ils vont siéger pendant une session ordinaire à Tsimbazaza. Du côté d’Anosikely, la HCC n’a pas encore été saisie de la vacance d’un siège de sénateur suite à la nomination en qualité de ministre de la Communication et des Relations avec les Institutions de Riana Andriamandavy VII que l’ensemble de la presse souhaite le remplacement dans le gouvernement par un …suppléant.

Recueillis par R. O

News Mada4 partages

« Mondial 2018 » : “mangoron-damba” i Egypta sy i Maraoka

Taorian’ny namontsanan’i « Sbornaya », ny Rosianina,  an’i Arabie Saodita, 5 no ho 0, mbola lavony indray tamin’ny isa 3 no ho 1 i Egypta, samy nisantatra ny lalao faharoa ao amin’ny vondrona A. Ny baolina voalohany, namono tena ry zareo Egyptianina, teo amin’ny minitra faha-47, ny baolina faharoa, matin’i Denis Cheryshev, minitra faha-59 ary ny baolina fahatelo, minitra faha-73, namboarin’i Artyom Dziomba. Nampihena ny isa kosa ho an-dry zareo Egypta, i Mohamed Salah, mpilalaon’ny Liverpool, nahatafiditra ny penalty , minitra faha- 3.

I Denis Cheryshev izany izao ny mpilalao faharoa nahatafiditra baolina be indrindra, telo, aorian’i CR7, baolina efatra. Mazava izany fa i Rosia, teo amin’ny lalao faharoa ny voalohany izao ao amin’ny vondrona misy azy : nahazo fandresena indroa, baolina  maty valo,  isa enina.

Tsy nanam-potoana nanatrika nivantana ity lalao ity ny filoha rosianina, i Vladimir Poutine. “Nambara taminy fotsiny ny fandresen’i “Sbornaya » an’i « Pharaons », ary faly tokoa ny filohanay. Namita iraka tany Minsk, Biélorussie, izy ”, hoy ny mpitondra tenin’i Kremlin.

Mbola naneho ny talentany i CR7, nampiditra ny baolina tokana, teo amin’ny minitra faha-4, nandresen-dry zareo Portogey ny Maraokanina, omaly. Tsy nambinina  i Maraoka na betsaka ihany aza ny tokony ho tafiditra. Faheresena fanindroany izao ho an-dry zareo Maraokanina, ao amin’ny vondrona B misy azy. Tsy maintsy nitady iny fandresena iny koa ny Portogey, taorian’ny ady sahala 3 no ho 3 nifanaovany tamin’i Espaina. I Egypta sy i Maraoka izany izao, efa karazany “mangoron-damba”.

Tsy nahita irika i Arabia Saodita nanoloana an’i Uruguay

Nitarika teo amin’ny minitra faha-23 i Uruguay, baolina tafidir’i Luis Suàrez. Somary nisy fahadisoan’ny mpiandry tsatobin-dry zareo Arabia Saodita ihany  io baolina tafiditra io , noho izy nivoaka, koa nohararaotin’i Luis Suarez izany, tamin’ny corner. Nitady ny nampitovy isa hatrany ry Saodianina, saingy tsy nahita irika. Teo amin’ny minitra faha-66, ohatra, tsara toerana avy amin’ny ilany ankavia i Al-Muwallad, nefa nalavon’i Gimenez, ary nahazo coup franc i Arabia Saodita, saingy tsy nisy vokany.

R.Mathieu

News Mada4 partages

Tourisme : les infrastructures et la sécurité, gage du développement

« Le tourisme seul peut-il développer Madagascar ? ». Une question à laquelle les acteurs du secteur tourisme ont tenté d’apporter un élément de réponse, lors de la conférence-débat organisée, hier, à l’hôtel Carlton Anosy. En fait, lorsque les infrastructures touristiques et la sécurité sont assurées, les avantages pour tous accroîtront.

Après l’agriculture et la pèche, le secteur tourisme contribue à hauteur de 7% du PIB national, plus que la contribution du secteur minier. «Lorsque les infrastructures touristiques et la sécurité sont assurées, les avantages pour tous accroîtront», a enchéri dans son allocution Stuart Wilson, chargé d’affaires de l’ambassade des Etats-Unis à Madagascar.

 «Sans conteste, le tourisme est un vecteur de développement dans la mesure où toutes les conditions exigées sont réunies. Il faut une synergie réelle pour atteindre l’objectif de transformer la Grande île en paradis touristique. Pour cela, il faut que l’Etat encourage et sécurise nos investissements, et contribue à la réalisation des infrastructures nécessaires (l’électrification, les routes, etc.)», a déclaré Tiana Rasamimanana, Chief of staff du Groupe Sipromad, étant également à l’origine de cette conférence qui vient quelques semaines après l’ITM.

Et ces indicateurs peuvent être améliorés davantage. Roland Rastiraka, ancien ministre du Tourisme va même jusqu’à affirmer : «En prenant en compte les besoins du secteur, il est tout à fait possible de doubler, en l’espace d’un an, le nombre de touristes visitant la Grande île».

Le rôle de chaque acteur

Face au regain d’insécurité, notamment pour les touristes, Jean Brunel Razafitsiandraofa, ministre du Tourisme, a assuré que des mesures ont été prises et que des stratégies de lutte sont mises en œuvre. Il a assuré en effet que la réussite de ces stratégies repose sur chaque acteur, allant des autorités concernées aux simples artisans locaux, en passant par les opérateurs œuvrant dans le tourisme.

 «Les acteurs du tourisme restent souvent dans l’ombre mais en fin de compte, ils sont bien des acteurs majeurs qui nourrissent plusieurs secteurs… Nous tous citoyens et résidents de Madagascar sommes acteurs du tourisme», a soulevé pour sa part Joan Place, un représentant du secteur privé.

Tout cela pour dire qu’il y a un besoin de renforcement de la professionnalisation du secteur tourisme à Madagascar ! Les résolutions de cette rencontre seront effectivement remises à l’Organisation mondiale du tourisme (OMT).

b

News Mada4 partages

Airtel madagascar : don de lampions à l’EPP Mahavelona

Incontournable durant le mois de juin, la distribution de lampions demeure une tradition pour Airtel Madagascar.

Cette année, comme à l’accoutumée, Airtel Madagascar a tenu à célébrer la Fête nationale avec les élèves de l’EPP Mahavelona. Plusieurs employés volontaires, conduits par Maixent Bekangba, directeur général de l’opérateur, se sont mobilisés au sein de cet établissement scolaire, le 20 juin, afin de distribuer des lampions  à tous les élèves.

 «Il est important pour Airtel Madagascar de marquer, comme il se doit, la commémoration de l’Indépendance de Madagascar qui unit le patriotisme de tous les Malgaches à travers le monde. Airtel rejoint cette célébration collective en offrant la possibilité, aux jeunes élèves de l’EPP Mahavelona, de célébrer les fêtes comme tous les autres enfants de leur âge…», a précisé  Maixent Bekangba  durant ce déplacement.

Pour rappel, les trois secteurs d’intervention de cet opérateur mobile, dans le cadre de la Responsabilité sociétale de l’entreprise (RSE), sont l’éducation, la santé et le développement numérique.

R.R.

News Mada4 partages

BOLO : un show en solo pour le 25 juin

Si l’année dernière, Kudéta Urban Club a été animé par le collectif Basy Gasy durant la nuit du 25 juin, cette fois-ci, l’ambiance sera assurée par Bolo et ses musiciens. «En fait, je voudrais être encore plus proche du public actuellement, lui montrer que Bolo n’est pas qu’un simple animateur de l’émission Clash Info, il est aussi un artiste, un chanteur qui a ses propres compositions», a annoncé l’artiste, lors de la conférence de presse qui s’est tenue, hier, au Kudeta Urban Club Anosy.

Ainsi, le 25 juin, à partir de 21h30, il sera accompagné sur scène de Rabary et Rijasolo à la guitare, Niri à la guitare basse et le beatboxer Tsirikely. Durant la soirée, ce dernier jouera en loop station, c’est-à-dire que le beatboxer composera en direct avec ses voix et Bolo chantera sur cette composition. «Le spectacle ne durera qu’une heure. Ce sera en fait une sorte d’aperçu de mon prochain projet», a –t-il souligné.

Par ailleurs, avant ce spectacle, le chanteur participera à la levée de fonds organisée par l’Is’art galerie dénommée «Revy eny an-kanja» qui se déroulera, le 23 juin, à Ambohitrombihavana.

Holy Danielle

 

Midi Madagasikara4 partages

Festivités du 26 juin- J-7 : La Préfecture d’Ambositra n’a pas encore reçu de subvention !

« Le Préfet d’Ambositra pour une revue à la baisse des dépenses du 26 juin ». Photo Anastase

Interrogée sur le programme de la célébration de la fête du 26 juin dans la préfecture d’Am -bositra, àmoins d’une semaine de la commémoration des 58 années de l’Indépendance du pays, le  Préfet  de révéler que son département n’a pas encore reçu de subvention à cet effet du « fanjakana » et que cette haute représentante de l’Etat entend revoir à la baisse le montant des dépenses prévues pour la manifestation.

SciemmentUn contexte presque analogue à toutes les collectivités décentralisées dans de telles circonstances  et les observateurs de la vie publique de se demander s’il s’agit d’une situation sciemment  voulue par le Pouvoir central et d’inciter les responsables locaux  à débourser de l’argent de leurs poches. Contrairement aux instances hiérarchiques qui, dans ce genre de situation(les ministères), se permettent aisément de financer des « paniers garnis » aux frais de l’Etat à ces membres du personnel. Un deux poids deux mesures que ces responsables locaux dénoncent et qui à la longue ne pourront pas  faire le pas… d’un défilé du 26 juin en toute indépendance.

Anastase

Midi Madagasikara4 partages

Accord politique TIM-HVM : Usurpation de signature, selon Me Hanitra

Le document comporte trois fausses signatures.

Un faux document comportant trois fausses signatures circule depuis hier sur les réseaux sociaux.

Y a-t-il eu un accord politique ou non  ? La question reste sans réponse depuis la nomination du Premier ministre de consensus Ntsay Christian. Dans sa brève intervention lors de la lecture du décret de nomination de ce dernier au Palais d’Etat d’Iavoloha, le président de la République Hery Rajaonarimampianina a affirmé l’existence d’un accord politique. En réplique, le président national du TIM Marc Ravalomanana a martelé qu’il n’a signé aucun accord politique. De même, le chef de file du Mapar Andry Rajoelina a démenti l’existence d’un accord sur la nomination du Premier ministre Ntsay Christian et des membres de son gouvernement et ce, malgré la déclaration du député Tinoka Roberto sur la Place du 13 mai. Avant-hier, des membres de l’instance dirigeante du parti HVM voulaient confirmer, lors d’une conférence de presse, l’affirmation de Hery Rajaonarimampianina en réitérant, sans être arrivés à montrer au public le document signé par les parties prenantes, qu’il y a eu un accord politique. Moins de 24 heures après cette conférence de presse, un document signé par le président de la République Hery Rajaonarimampianina, Marc Ravalomanana et Ramtane Lamamra circulait sur les réseaux sociaux.

Usurpation de signatures. La réaction du député TIM Hanitra Razafimanantsoa n’a pas tardé hier sur la Place du 13 mai. « Je réitère que le président Marc Ravalomanana n’a signé aucun accord politique. S’il y a un accord politique qui comporte sa signature, c’est une signature usurpée. », a martelé ce leader du « Mouvement pour le Changement ». Une manière pour elle d’affirmer que le document qui circule depuis hier sur les réseaux sociaux est un « fake », un faux accord dont l’auteur peut être poursuivi pour faux et usage de faux. En tout cas, sur la forme, le document en question est maladroitement rédigé et est truffé de fautes. Pour ne citer que l’utilisation de la dénomination « Organisation de l’Unité africaine» (OUA) au lieu de l’Union africaine. Tantôt, l’auteur du document utilise le signe TIM, tantôt, il utilise la dénomination « Mouvance Ravalomanana », deux entités tout à fait différentes. Sur le fond, le document comporte des dispositions inimaginables, voire impossibles. C’est notamment lorsqu’il prévoit dans son article 4 : « Pour garantir la stabilité, le Mapar est un adversaire politique unique pour le TIM et HVM. Le mouvement populaire de la place du 13 mai sera financé par le régime actuel à des fins de stratégie politique ». Et encore en son article 6, le document stipule : « Toute élection au suffrage universel sera reportée en 2019, sous réserve de la constitution préalable du nouveau bureau de la CENI. D’autre part, les deux parties se mettent d’accord sur l’hypothèse d’un candidat unique présenté par les partis politiques TIM et HVM. »

Enjeux. Par ailleurs, l’article 7 du document dispose : « La mouvance Ravalomanana endosse la responsabilité d’attaquer le Mapar pour le discréditer avant et pendant la campagne présidentielle de 2019. » Bon nombre d’observateurs se posent deux questions : Peut-on imaginer que Ramtane Lamamra, un diplomate de haut niveau reconnu mondialement, peut cautionner ce genre d’accord politique ? Qui a intérêt à inventer et à faire circuler ce genre de document ? En tout cas, les enjeux sont énormes. Pour le HVM, s’il y a eu un accord politique, cela veut dire que la décision n°18 de la HCC ne s’applique pas. Et en conséquence, on ne peut que se référer à la Constitution quant à la détermination du calendrier de la prochaine élection présidentielle.  Dans leur raisonnement, Rivo Rakotovao et consorts veulent non seulement justifier la présence des ministres issus du HVM dans le gouvernement de Ntsay Christian, mais aussi écarter toute éventualité d’une présidentielle anticipée évoquée dans la décision du juge constitutionnel.  Reste à savoir pourquoi le HVM ne divulgue pas l’accord politique auquel il a fait allusion pour couper court aux polémiques sur la question.

R. Eugène

News Mada3 partages

Partenariat public-prive : le Gem reçu à Mahazoarivo

Le Premier ministre Christian Ntsay a reçu en audience, hier, au palais d’Etat de Mahazoarivo, les représentants du Groupement des entreprises de Madagascar (Gem), conduits par leur présidente Noro Andriamamonjiarison.

Misant sur la contribution du secteur privé dans le développement, le Gem a mis en exergue deux sujets importants, dont l’économie et le problème d’insécurité. Selon ses dires, les opérateurs économiques focalisent leur attention sur les actions concrètes à mener pour relancer l’économie, et les éventuelles décisions qui seront prises concernant certains grands dossiers.

La venue de quelques membres de la chancellerie étrangère, entre autres, l’ambassadeur de l’Allemagne, celui de Suisse, ainsi que les représentants de la Banque africaine de développement (Bad), la représentante résidente de la Banque mondiale et le représentant résident du Fonds monétaire international (FMI), a également marqué la journée.

L’entrevue avec la Banque mondiale et le FMI était axée sur les réformes que ces deux institutions financières entreprennent, notamment dans le cadre de Facilité élargie de crédits (FEC) avec le FMI et en particulier, le programme de réforme du secteur financier, appuyé par la Banque mondiale.

Arh.

Midi Madagasikara3 partages

Fête de l’Indépendance : Ravalomanana et Rajoelina seront absents

L’année dernière, Marc Ravalomanana et Andry Rajoelina n’ont pas fait le déplacement, ni à Mahamasina ni à Iavoloha. En revanche, l’amiral Didier Ratsiraka a été présent au défilé militaire, mais il a boudé le grand banquet d’Iavoloha.

Dans moins d’une semaine, on va fêter le 58e anniversaire de notre indépendance. Dans le cadre de ces festivités, des cartons d’invitation ont été envoyés aux  différentes personnalités du pays. De source bien informée, , il n’y aura pas d’invités d’honneur venant de l’étranger. En revanche, ils seront représentés par leurs ambassadeurs respectifs à Madagascar. Bref, pas de chefs d’Etat ni de chefs de gouvernement. Et ce n’est pas la première fois. Ce serait ainsi une cérémonie malgacho-malgache.

Grand banquet. Notons que comme à l’accoutumée, il y aura dans la matinée le défilé militaire et dans l’après-midi, un grand banquet sera donné au Palais d’Etat d’Iavoloha. Sur le plan local, les anciens Présidents seront invités pour assiter à ces différentes cérémonies. Reste à savoir s’ils vont répondre présents. A propos notamment du fondateur de l’empire Tiko et de l’initiateur de la révolution orange, ils seront absents du pays, lors de la fête de l’Indépendance.

Festivités. Les chefs d’Institution, les membres du gouvernement, les députés et les sénateurs ainsi que le corps diplomatique ont été également invités. A cela s’ajoutent les chefs de régions et bien d’autres hautes personnalités. La sécurité publique sera probablement renforcée, lors de la célébration de la fête de l’Indépendance. Des mesures concrètes seront ainsi prises, lors de ces festivités. Rappelons que le 26 juin de l’année dernière a été placé sous le thème de « Mamiko ny taniko, ny fisandratany no fanambiko ».  

Dominique R.

News Mada2 partages

Traitement des douleurs : des moyens non médicamenteux développés

L’ONG Douleur sans frontière (DSF) ne cesse de chercher des moyens pour améliorer la prise en charge de la douleur et de la souffrance des patients usagers du système national de santé à Madagascar. Cette année, l’organisme a exploité des techniques non-médicamenteuses, efficaces et souvent peu onéreuses, pour permettre aux patients de bénéficier des moyens antalgiques afin de prévenir les douleurs induites ou chroniques, en vue de limiter, autant que possible, la prise de médicaments. Il s’agit notamment, de l’hypnose analgésique, la distraction ou encore la neurostimulation électrique transcutanée ou « Tens ».

« Cette dernière méthode, qui consiste à utiliser de l’énergie électrique, via un appareil générant du courant, afin de soulager la douleur, peut être appliquée à toute sorte de douleur. Mais, y accéder demeure encore limité dans le pays, dans la mesure où l’appareil n’est pas encore disponible dans les officines pharmaceutiques locales », a souligné un médecin traitant au sein du Centre national   de lutte contre la douleur (CNLD) dans la capitale, le Dr Isthman Randriamisaina. C’était hier, à l’HJRA, à Anosy, lors d’une conférence-débat sur la « Douleur et les soins palliatifs », un événement qui entre dans le cadre de la célébration des dix ans d’intervention de DSF à Madagascar. « Une occasion pour les acteurs, composés de médecins, étudiants, membres de la Société civile et représentants des ministères concernés…de voir comment améliorer davantage la prise en charge de la douleur dans le pays », a informé le directeur national de DSF à Madagascar, Tianarivo Rasoanambininjanahary.

Prise en charge gratuit…

« Actuellement, 15 à 30 patients par semaine sont traités par l’appareil de « Tens », au sein du CNLD dans la capitale.  Ils sont composés essentiellement de patients souffrant de douleurs dorsales, dues aux hernies discales ou autres pathologies. Mais, les patients qui suivent des traitements antidouleurs sont en  majorité des victimes de cancer », a poursuivi le Dr Isthman Randriamisaina. Et d’enchainer : « Le traitement peut s’étaler sur un mois et demi si la maladie est traitée, sinon ceci devrait se faire de manière continue, à raison de trois séances par semaine ».

Outre les médicaments nécessaires, l’ensemble des prises en charge  effectuées par DSF est gratuit, y compris les accompagnements psychologiques des victimes et de leurs familles en cas de besoin. L’organisme, qui intervient également dans l’appui aux volets formations universitaires, aspire à ce que l’Etat puisse prendre le relais une fois son projet terminé.  Sur ce, il faut reconnaitre qu’il reste beaucoup à faire si on se réfère uniquement au fait que le pays enregistre seulement 26 médecins spécialistes dans la prise en charge de la douleur…

Fahranarison

 

News Mada2 partages

Extraction minière : la Chine dispense des formations

La Chine renforce son appui dans le secteur minier à Madagascar. Des techniciens chinois sont actuellement à Madagascar pour dispenser des formations dans ce domaine.

Quarante techniciens malgaches, dans le domaine de l’extraction minière, bénéficient actuellement d’une formation sur la technologie minérale et géologique à Madagascar, attribuée par le gouvernement chinois.

La Chine renforce son appui à la gouvernance minière à Madagascar. Les techniciens malgaches, issus du ministère des Mines et du pétrole, et  des étudiants de l’Université d’Antananarivo ont débuté la formation, hier, à l’Institut Conficius à l’Université d’Antananarivo. Et cela jusqu’au 3 juillet prochain. Une formation organisée par le ministère des Mines et du pétrole, le ministère en charge des ressources naturelles en Chine, le Bureau d’enquête géologique de la Chine et le centre de développement de la recherche chinois.

Renforcement de capacités

Concrètement, la formation vise à renforcer les ressources humaines à Madagascar pour l’évaluation du capital des ressources naturelles malgaches, lequel n’est toujours pas réellement défini jusqu’à présent. A ce sujet, la Chine a déjà accompagné le gouvernement malgache dans la réalisation de la cartographie des ressources géologiques du pays en 2016. «Cette formation permettra aux techniciens malgaches de renforcer les investigations déjà réalisées dans ce secteur», a précisé le ministre des Mines et du pétrole, Henry Rabary-Njaka.

Cette coopération Sud-Sud, initiée par la Chine, date depuis 2004. La Chine invite périodiquement des techniciens venant des pays du Sud à suivre la formation dans le secteur de l’extraction minière. Le gouvernement chinois a décidé plus tard de déployer des techniciens vers les pays partenaires pour dispenser la formation, comme c’est le cas actuellement à Madagascar.

Rakoto

 

Midi Madagasikara2 partages

Filière bovine : Insémination de 1 500 semences à Bongolava

Le ministère en charge de l’Agriculture et de l’Elevage via sa direction d’Appui au Développement Zoo-génétique (DADZ) procède actuellement à une campagne d’insémination artificielle en vue d’une amélioration génétique de la race bovine à Madagascar. Près de 1 500 semences de race Brahman et Limousine seront ainsi inséminées gratuitement dans la région de Bongolava. L’objectif de ce projet est d’améliorer la race bovine destinée à la consommation ou à la production laitière par l’intermédiaire d’un croisement génétique qui vise à augmenter le poids des bovins. D’après les explications du directeur général de l’Elevage, le Dr Raymond, ces croisements sont sans risque pour les femelles bovines locales. Notons que ces 1 500 semences ont été obtenues grâce à un partenariat du ministère de tutelle avec la société Mada Ranch. Celle-ci s’engage également à acheter les bovins issus de cette amélioration génétique tout en apportant son appui au niveau de l’amélioration de la santé animale.

Navalona R.

Midi Madagasikara2 partages

Partenariat Telma – Baobab + : Faciliter l’accès à l’énergie solaire

Mathieu Macè, Administrateur général de Telma et Olivier Mutsaerts, Directeur de Baobab + Madagascar ont présenté, le « Pay-As-You-Go », une solution innovante pour l’accès à l’énergie solaire.

L’énergie solaire est une opportunité exceptionnelle pour les foyers ruraux n’ayant pas accès à l’électricité.

L’énergie renouvelable est à la mode. Du coup, les bonnes initiatives se multiplient pour permettre au plus grand nombre d’accéder à l’énergie solaire. C’est le cas notamment de Telma M’Vola et de Baobab + qui se sont associés afin de faciliter l’accès à l’énergie solaire pour les ménages à faible revenu.

Deux leaders. Une association entre deux leaders dans leur secteur respectif. D’un côté, M’Vola, la première entreprise de solution par paiement mobile à Madagascar et de l’autre, Baobab +, l’un des principaux distributeurs de kits solaires en Afrique de l’Ouest et à Madagascar. Dénommée « Pay-As-You-Go », l’offre proposée par les deux compagnies permet de lever le frein majeur du prix et de rendre les  produits accessibles aux personnes à faible revenu en s’adaptant à leurs habitudes de dépenses. Le principe consiste à demander au client un dépôt initial de 30.000 ariary. Ce dernier réalise ainsi des paiements journaliers ou hebdomadaires en fonction de ses capacités. Chaque paiement lui permet d’utiliser son produit et d’en devenir, à terme, le propriétaire. En effet, après paiement échelonné et par M’Vola de la totalité de la valeur du  produit, il en devient définitivement propriétaire.

Impacts bénéfiques. Ce mode d’accès à l’énergie solaire est d’autant plus facilité dans la mesure où la durée moyenne de remboursement est d’une année. Le foyer bénéficiaire peut, ainsi réaliser des économies et même investir en utilisant son kit pour des activités professionnelles  En tout cas, ce partenariat Baobab + M’Vola permet aux clients de Baobab + de rembourser leurs kits solaires où qu’ils soient et quand ils souhaitent et ce, sans frais supplémentaires. De l’énergie renouvelable à accès facile, en somme et avec ce que cela suppose d’avantages. En effet, dans la vie quotidienne, l’accès à l’énergie solaire a un certain nombre d’impacts bénéfiques  entre autres, l’augmentation de 75% du temps d’étude des enfants, contrairement aux bougies traditionnelles, la lampe solaire est plus durable et plus claire. Son utilisation augmente de 25% les revenus des foyers. D’après un sondage, 94% des utilisateurs se sentent plus en sécurité et 84% constatent une amélioration de la qualité de l’air, par rapport à l’utilisation d’autres énergies.

Le choix de Telma en tant que fournisseur de solutions de paiement par mobile est d’autant plus intéressant dans la mesure où M’Vola couvre plus de 80% de la population malgache. De plus, pour faciliter les opérations, un menu M’Vola a été mis en place pour Baobab +.

R.Edmond.

Midi Madagasikara2 partages

Toliara – Droit de la femme : L’association des femmes luthériennes dénonce la coutume qui délaiss...

Les femmes se plaignent encore et toujours.

Apparemment, rien n’a changé. Les femmes sont toujours à plaindre. C’est ce qu’on remarque selon le film documentaire projeté par l’association des femmes luthériennes en partenariat avec  la « Transparency International » (Association luttant contre la corruption) à l’Hôtel Amazone, Toliara le 15 juin dernier. L’homme de la Région Sud- Ouest domine toujours dans le couple. C’est quand il décède que les problèmes apparaissent. La coutume veut que la famille du défunt   accapare  tous les biens acquis durant l’union   et laisse  la veuve éplorée sur le pavé.

Malgré la trentaine d’associations œuvrant dans le monde de la femme, rien n’y fait. Selon les membres de ces associations, la communauté internationale prévoit un budget pour le deuxième sexe, malheureusement l’accès est très difficile. L’association des femmes luthériennes compte sur le Ministère de la Population et de la Promotion de la Femme, et la communauté internationale basée à Madagascar de venir en aide à toutes ces femmes laissées au ban de la société.

Charles RAZA, correspondant

Midi Madagasikara2 partages

Commerce et consommation : Une opération coup de poing contre les produits périmés

La période festive, c’est bien évidemment les festins. Mais elle est aussi un moment où les intoxications alimentaires sont fréquentes. Notamment les accidents provoqués par l’absorption de denrées alimentaires périmées. Raison pour laquelle, le ministère du Commerce et de la Consommation a décidé de lancer, depuis hier, une opération « coup de  poing » destinée à contrôler les produits alimentaires périmés. Une manière de parer aux mauvaises habitudes de certains commerçants malintentionnés qui profitent des fêtes pour faire écouler sur le marché des denrées alimentaires périmées, avariées et non conformes. Pour rassurer les consommateurs, le Ministère du Commerce et de la Consommation met un point d’honneur à accomplir son rôle principal qui est  de protéger les consommateurs. Il , procèdera donc à une opération de contrôle économique dans toutes les régions de l’Ile. Pour éviter les usurpateurs, les commissaires et contrôleurs du commerce et de la concurrence qui effectuent ces missions sont munis d’un ordre de mission émanant du ministère du Commerce et de la Consommation dans lequel sont mentionnés les noms et qualités des agents, l’objet, les lieux et dates du contrôle.

R.Edmond.

Midi Madagasikara2 partages

ATSINANANA : Ivontoerana “CTHT – CTCP” Toamasina Nahazo famatsiam-bola fito miliara avy amin’ny von...

Isan’ny ivontoerana iray manampy betsaka ireo tantsaha mpamokatra vokatra fanondrana sy vokatra tropikaly ary ireo vokatry ny tany eto Toamasina, na ara-teknika izany na ara-piaraha-miasa, ny ivontoerana CTHT na “Centre Technique Horticole de Toamasina” sy ny sampan CTCP na “Centre de Transformation et de Conservation des Produits” ao Analamalotra Toamasina Suburbaine. Mba hahafahany manatontosa ny asany dia nisy hatrany ny fiaraha-miasany tamin’ny vondrona eropeana amin’ny famatsiana vola ny tetikasany, ho fanatsarana ny vokatra hamatsiana ny tsena anatiny sy ny tsena any ivelany, indrindra ny firenena eropeana, izay tena mpividy ny vokatry ny tany sy tropikaly malagasy. Ho fanamafisana izany, izay tafiditra ihany koa amin’ny famatsiam-bola FED faha-09 sy ny FED faha-10 ataon’ny vondrona eropeana an’i Madagasikara, dia tafiditra tamin’ireo nahazo famatsiam-bola tamin’izany ny ivontoerana CTHT – CTCP Toamasina. Tonga teto Toamasina mihitsy ny masohivohon’ny vondrona eropeana, Atoa Antonio Sanchez-Benedito, miasa sy monina eto amintsika, nanato Sonia izany, sy ny filohan’ny filankevi-pitantanan’ny ivontoerana, Atoa Dama Jean Luc, famatsiam-bola mitentina 07 miliara ariary ary ampiasaina mandritra ny 05 taona. Tetikasa telo no ampiasana ny vola, ny voalohany mikasika ny fanampiana amin’ny alalan’ny fampitomboana ny traikefan’ireo tantsaha amin’ny famokarana ataony ; ny faharoa dia ny fanofanana ireo mpandraharaha mpanondrana sy ireo mpanangom-bokatra ; ary ny fahatelo kosa dia ny fiaraha-miasan’ny ivontoerana amin’ny Procom amin’ny fanatsarana ny fitaovana eo anivon’ny ivontoerana CTCP mba hahazoana ny fenitra “certificat 17.025”. Raha tanteraka izany dia ny CTHT – CTCP izany no faharoa manana izany eto amintsika ankoatra ny “Institut Pasteur de Madagascar”. Niatrika izao lanonana fahazoam-bola izao amin’ny angady sy vy nahitana ny ivontoerana CTCP Atoa Narson Rafidimanana, izay filoham-boninahitry, sy ny talen’ny ivontoerana Atoa Andréas Christophe.

Malala Didier

Midi Madagasikara2 partages

Madagascar-Chine : Rehausser le niveau des techniciens sur la géologie minérale

Le ministre des Mines et du Pétrole, Henri Rabary-Njaka et le Premier Conseiller de l’Ambassade de Chine à Madagascar, Chen Xiaolei.

L’organisation d’un séminaire de formation visant à renforcer les compétences des techniciens malgaches permet de raffermir la coopération entre Madagascar et la Chine en matière de développement des ressources humaines.

Un atelier de formation en technologie minérale et géologique de Madagascar se tient depuis hier et durera dix jours à l’Institut de  Confucius de l’Université d’Antananarivo. L’atelier est  organisé conjointement par le ministère des Ressources naturelles de la République Populaire de Chine et le ministère en charge des Mines et du Pétrole de Madagascar, ainsi que le Bureau de Recherche géologique de Chine (CGS). « L’objectif de ce séminaire de formation y compris le partage d’expériences de la Chine consiste à rehausser le niveau des techniciens malgaches afin qu’ils puissent être en mesure d’évaluer correctement la potentialité de nos ressources minérales et ensuite de les gérer », a expliqué le ministre en charge des Mines et du Pétrole, Rabary-Njaka Henri, lors de l’ouverture officielle de cet atelier de formation hier. Ce qui permettra également de raffermir la coopération sino-malgache  en matière de développement des ressources humaines.

Modèle de réussite. En effet, « indépendamment des activités de prospection et d’exploration, l’industrie extractive requiert une connaissance approfondie de la nature et des caractéristiques de notre sous- sol ainsi que ses ressources minérales. En outre, la Chine est un des grands producteurs de minerais, dont entre autres le zinc, le charbon, le cuivre et l’argent. Et elle a fait également le lien entre les richesses naturelles, la formation et l’industrialisation. Maintenant, l’heure en est à la tertiarisation de son économie. Ses expériences sont notables, notamment dans le domaine extractif. Et son expertise et son modèle de réussite dans la prospection géologique peut nous servir énormément pour le développement de notre secteur extractif », a-t-il poursuivi. Notons qu’une quarantaine de personnes dont 35 techniciens issus des services déconcentrés dans les régions et de la direction centrale du ministère concerné et cinq étudiants spécialisés dans le domaine de la géologie au sein de l’Université d’Antananarivo, bénéficient de cette formation prodiguée par des experts chinois du centre de Développement et de Recherche du CGS. A l’issue de cette formation, les techniciens malgaches  pourront se familiariser avec les méthodes et les techniques de cartographie géologique ainsi que celles de l’informatisation des produits et services socialisés en cartographies géologiques.

Capital humain. « Pour les non-initiés, les études sur les ressources minérales sont capitales. Et le meilleur des investissements constitue l’éducation et la formation du capital humain », a enchaîné le ministre de tutelle. Il faut savoir que Madagascar envisage de faire de son secteur extractif, un levier de développement contribuant à la lutte contre la pauvreté. Et en tant que pourvoyeur de ressources, l’industrie minière devra permettre d’avoir des retombées économiques positives et concrètes au niveau de la population. Le Premier Conseiller de l’Ambassade de la République Populaire de Chine à Madagascar, Chen Xiaolei a également soulevé que le renforcement de la capacité des ressources humaines contribue au développement d’un pays. Quant au Président de l’Université d’Antananarivo, Panja Ramanoelina, il a évoqué que l’organisation de ce séminaire de formation au profit des techniciens malgaches  représente la concrétisation de la convention de partenariat entre son département, l’Université de géologie de la Chine et du Bureau de Recherche Géologique de la Chine. « Cette convention tripartite durera cinq ans. Et c’est à travers les échanges et le partage d’expériences qu’il y a un développement », a-t-il conclu.

Navalona R.

Midi Madagasikara2 partages

AMORON’I MANIA : « Alliance Française » – Ambositra Mankalaza ny « fête de la musique »

Toy ny  isan-taona amin’ny volana jiona, dia mankalaza  ny “fête de la Musique” ny ao amin’ny « Alliance Française ». Hetsika ara-koltoraly tafiditra ao anatin’ny fampiroboroboana ny sehatra zavakanto sy fanomezan-danja ireo mpanakanto vao misondrotra. Fampiroboroboana ny sehatra zavakanto izay nanomboka ny asabotsy 16 jiona ary haharitra herinandro, ka hahitana hetsika maro samihafa, toy ny mozika isan-karazany,  ny dihy ary ny « théâtre » sy ny « atelier » mahakasika an’izany. Misy ihany koa ny fampahanfantarana ireo fitaovana isan-karazany, na ny « instruments » ampiasana  amin’ireo mozika isan-karazany.  Ny tontolon’ny mozika izay sehatra iray ivondronan’ireo artista avy eto amin’ny faritra sy ireo avy any ivelany ao anatin’ny fahasamihafana, ny  firaisankina sy fifanakatiavana, ary ny fizarana ny  traikefa. Marihina fa noho izao ezaka izao, dia tsy vitsy ireo artista avy eto an-toerana no efa manana ny lazany manerana ny nosy sy any ampitan-dranomasina any .

Anastase

Sary tahiry “ny 26 jiona tamin’ny taon-dasa tarihin’ny “préfet d’Ambositra”. (sary Anastase )

Fankalazana ny fetin’ny  26  jiona

Prefektioran’ Ambositra, mbola tsy tonga  ny subvention”  avy amin’ny fanjakana  foibe

Herinandro latsaka dia  ho tonga ny fankalazana ny fetin’ny faha-58 taona nahazoan’ ny Nosy ny fahaleovantena, ka hankalazaina amin’ny fomba manetriketrika. Fantatra nandritra ny resaka nifanaovanay tamin-dramatoa “Prefet d’Ambosira” fa sahiran-tsaina ity tompon’andraikitra ambony ity, fa mbola tsy tonga ny “subvention” avy amin’ny fanjakana foibe natokana ho amin’izany. Voatery, hoy ihany ity solontenan’ny fanjakana foibe eto Ambositra ity, ny hanao antso avo ho amin’ireo mpisehatra eo amin’ny sehatra tsy miankina amin’ny fanomezana tanana hanatanterahana an’ity fety ity. Nomarihin’ny “préfet d’Ambositra”, fa vao tsy ela akory no naloa ny vidin’ny “reception” natao tamin’ny 26 jiona taon-dasa. Raha eo anivon’ny distrika sy ny kaominina, hoy ireo lehiben’ny tanàna, toa efa mahazatra izao toe-javatra izao, ka matetika, vaotery ireo tomponandraikitra mamoka vola am-paosiny. Mifanohitra amin’izany ny zava-misy ao amin’ireny ministera maro sy  ireo andrim-panjakana samihafa afaka mankalaza izany amin’ny vola efa eo am-pelatanany izy ireo.

Anastase            

Midi Madagasikara2 partages

Place du 13 mai : Haro sur les députés « Mpamadika »

Les manifestations se poursuivent sur la Place du 13 mai.

Les manifestations sur la Place du 13 mai se poursuivent. Hier, le député Hanitra Razafimanantsoa n’a pas mâché ses mots contre les députés qui n’arrivent plus au Parvis de l’Hôtel de ville pour soutenir les revendications du « Mouvement pour le Changement ». « Vous avez trahi le peuple. », a-t-elle martelé. Une allusion certaine aux députés du Mapar et à ceux qui ne fréquentent plus la Place du 13 mai.

Syndicalistes. Outre les députés du TIM, les syndicalistes deviennent de plus en plus actifs sur la Place du 13 mai. Le Parvis de l’Hôtel de ville d’Analakely devient ces derniers temps l’endroit par excellence pour les différents syndicats de faire entendre leurs revendications. Aujourd’hui, ces syndicats envisagent de taper fort.

R. Eugène

News Mada1 partages

Fiainam-pirenena : takin’ny Malagasy miara-miainga ny datim-pifidianana

 Ela fikenona loatra ? Anisan’ny nivoitra  tamin’ny valandresaka ho an’ny mpanao gazety nataon’ny  antoko  Malagasy miara-miainga ny hiatrehantsika ny fifidianana. Notakin’ity antoko naorin’Andrianainarivelo  Hajo  ity ny hamoahana ny datin’izany fifidianana izany.

Avoahy ny datim-pifidianana… Tokony hirosoana ny fifidianana… Hita izao fa voahitsakitsaka ny didy tsy azo ivalozana navoakan’ny  Fitsarana  avo momba  ny lalàmpanorenana (HCC) ny 25 mey lasa teo ”, hoy ny filoha  nasionaly, Andrianainarivelo Hajo teny amin’ny foiben-toeran’ny antoko eny Ankerana, omaly. Mampametra-panontaniana ny antoko Malagasy miara-miainga ihany koa ny amin’ny fahavononan’izao governemanta vaovao izao sy ny Praiminisitra Ntsay Christian na tsia ny hikarakara fifidianana mialoha  ny fotoana.   “Tsy nasiana resaka, na kely akory aza, ny momba ny fikarakarana io fifidianana io nandritra ny filankevitry ny minisitra notanterahina, omaly”, hoy  ihany izy.

Depiote namadika palitao niofo ho  HVM

Etsy andaniny, nohitsiny  fa tsy nisy ny fihaonana teo amin’ny filohan’ny antoko Malagasy miara-miainga sy ny filoham-pirenena na koa ny filohan’ny antoko HVM.

Etsy andaniny, takin’ity antoko naorin’Andrianainarivelo Hajo ity koa ny tokony hamalian’ny HCC ny fitoriana napetraky ny antoko Malagasy miara-miainga teny Ambohidahy ny 8 jona lasa teo.  Anisan’izany  ny momba ireo depiote eo anivon’ny VPMMM, namadika palitao, niofo ho HVM amin’izao  fotoana izao.

Synèse R.

News Mada1 partages

Mpampianatra sady filozofy, Rasoloarimanana Jerome : « tsy mahomby ny fakana tahaka fa aleo jerena ny ma...

 Nivahiny  tao amin’ny onjampeo Alliance 92 FM amin’ny alalan’ny  fandaharana “Ambarao”  ny mpampianatry ny oniversite katolika (UCM) sady filozofy,  ny profesora Rasoloarimanana Jerome. Nambarany fa tsy mety ny  fandikana vilana amin’ny any ivelany. Ampahany amin’ny resadresaka…

Tsy  mahomby  ny  fandikana vilana sy ny fakana  tahaka na lasitra efa nampiasaina tany  ivelany  fa aleo miverina mijery ny  amin’ny eto an-toerana. Tsy tokony  hihazakazahana ny indostria be ho an’ny famokarana  sy ny  fanondranana  ny vokatra  tsy voahodina. Jerena ny mampivoatra ny olona amin’ny maha Malagasy antsika, mifandray amin’ ny tanintsika”, hoy izy. Nohitsiny fa manana ny maha  izy antsika  isika ka tokony hifotorana izany.  Etsy andaniny, nambarany fa anisan’ny nampitotongana ny fiarahamonina sy ny olan’ny firenena ny tsy nandraisan’ny rehetra ny  hafatra. “Tsy tafita  izany satria  lavitra ny tanjona ny olona beazina.  Tsy misy koa ny fitaovana. Tsy misaraka ny fanabeazana sy ny maha olona  ho amin’ny fibeazana. Lasa mitory teny any an’efitra ihany isika. Tokony hanaraka hatramin’ny farany ny fivoaran’ny  fanabeazana sy manara-maso  izany  ny mpanabe fa tsy mampita  fahalalana sy fanabeazana na hamela  fotsiny  ireo mpianatra  amin’izao”, hoy izy.

Mamolavola olona vanona sy mahaleo tena…

Nanteriny koa  fa tsy misy dikany ny  fampianarana raha atao tsianjery ny fianarana. Raha tsy hain’ny beazina koa ny mampihatra izany. Ilaina koa anefa ny tombana, araka ny fanamafisany.  Misy antony ny tsy hahatongavana amin’izany, raha ny fijerin’ity mpampianatra ity . “Mihevitra ny mpanabe fa asa fotsiny io. Tsy mametraka ny maha fanabeazana hamolavola olona vanona sy mahaleo  tena hiatrehana ny fiainana. Afaka miatrika ny fisahanana ny fiainana ankapobeny andavandro. Tsy tokony hanana toetsaina hiankin-doha lava…”, hoy ny  profesora Rasoloarimanana Jerome.

Ankoatra  izany, anisan’ny olana ho antsika  eo amin’ny fanabeazana sy ny fampianarana ny tsy  fananantsika fandaharam-pianarana na rafi-pampianarana mamaly ny filana maha maha Malagasy antsika,  araka  ny nambarany.  Notsindriny  fa mbola  mifahatra kokoa amin’ny fifandraisana mivantana amin’ny fanatsarana ny tontolo voajanahary ny malagasy.  Ohatra  ny  fambolena sy ny fiompiana ary ny asa tanana.  “Jereo amin’ny maso  tsy miangatra fa misy velaran-tany midadasika  azo ambolena. Trandrahintsika ny harena ao ambanin’io. Mizaka fatiantoka telo isika  avy eo. Toerana tokony hambolena,  zary lasa simba. Ny ao ambany koa efa voatrandraka nefa tokony hiahiana  ireo taranaka any afara. Mihazakazaka  be loatra amin’ny fitrandrahana harena an-kibon’ny tany isika. Simba  koa ny  tontolo iainana ary tantely afa-drakotra sy gaboraraka ny harentsika… Jerena mandrakariva ny zava  misy eo an-toerana sy ny kolontsaina ny rafi-pampianarana…”, hoy izy.

Miankin-doha  lava  fa tsy mikaroka

 Momba ny fari-pahaizan’ny tanora kosa,  nambarany  fa tsy marani-tsaina ny maro amin’ireo mpianatra. Efa manana fitaovana izy ireo ary afaka mandranto  fahalalana  noho ny sehatra samihafa, toy ny teknolojia. Lasa zatra tolorana ny tanora amin’izao fotoana  izao. Tsy  manana toetsaina te hikaroka fa miankin-doha lava. Notsiahiviny fa fomba tsara koa ary azo haverina ny famerenana ny fomba fampianarana taloha. Anisan’izany  ny fianarana  fanampiny arahi-mason’ny  mpampianatra ankoatra ny ora any an-tsekoly.

Noresahiny avy eo ny momba ny LMD. Mipetraka amin’ny teny ifanarahana izany, saingy tsy tena misy mampihatra azy. Anarana izy io ary famantarana ahafahana milahatra amin’ireo firenena hafa…

Mamboly toetsaina tia mangala  tahaka… 

 Ny atao ao anefa, mbola  ny fomba fampianarana taloha ihany. Ilaina ny   fahazoana ny teknolijoa amin’ny LMD nefa  tsy manana solosaina ny mpianatra.  Na  manana koa aza anefa, zavatra hafa ny ataony  fa  tsy hikaroka.  Ny  loza koa ao anatin’izany ny fambolena toetsaina tia mangala tahaka sy mandika ny fikarohana sy ny vitan’ny any ivelany fotsiny,  araka ny nambarany…  “Tsy misy azo antenaina amin’ny mpandika fotsiny ary tsy misy zava-baovao ao anatin’izany. Mamerina toy ny boloky isika. Mila fikarohana ary ampiana sy tohanana ny tanora. Esorina aminy ny fiankinan-doha sy mandray fotsiny amin’ny fomba moramora.. . Marobe ny manana diplaoma nefa tsy misy atao. Ny hikaroka miainga amin’ ny tena  tsy hain’ny tanorantsika…”, hoy ity profesora ity.

Synèse R.

 

News Mada1 partages

« Raharaha baomba » – Jumbo Score : olona efatra voasambotra, vehivavy ny iray

 Mbola ao anatin’ny fanadihadiana ireo jiolahy efatra (vehivavy ny iray) voarohirohy ho tompon’antoka tamin’ny fampihorohoroana tao amin’ny Jumbo Score Tanjombato, ny zandary avy ao amin’ny sampana fikarohana heloka bevava eny Fiadanana. Araka ny fampitam-baovao voaray, ny telo tazonina ao amin’ny zandary raha mbola manaraka fitsaboana eny amin’ny hopitaly kosa ny jiolahy iray noho izy nianjera tampoka satria fanina nandritra ny fanadihadiana nataon’ny zandary. Niainga tamin’ny fitsirihana ny telefaonina finday nampiasain’ireo olon-dratsy tamin’io fotoana io no nahafahan’ny zandary nisambotra azy ireo. Niaiky ny fandraisan’izy ireo anjara tamin’ity raharaha ity ireo voarohirohy nandritra ny fakana am-bavany azy ireo, izay voaray horonampeo hatramin’ny farany na ny fotoana na ny fihetsika nataon’izy ireo nametraka ilay voalaza fa baomba. Momba ilay baomba nentin’ireo olon-dratsy nampihorohoro indray, rehefa nojerena tamin’ny antsipiriany, famantarana ora fametraka amin’ny rindrina, fikikisana karaoty, pince natao tanaty baoritra ka natao miendrika baomba, raha ny fanazavana voaray hatrany. Tsiahivina fa ny alakamisy 7 jona 2018 no nitrangan’ilay fampihorohoroana tao amin’ilay tranombarotra. Nangataka vola 10 tapitrisa Ar tamin’ny mpitantana ity tranombarotra ity ireo jiolahy fa raha tsy izany hapoakan’izy ireo ilay voalaza fa baomba napetraka tao amin’ny trano fivoahana. Mitohy ny fikarohana ataon’ny zandary ny naman’ireto jiolahy ireto.

J.C

News Mada1 partages

Tandindonin-doza… : ahina ho foana ny fizahantany mankany Menabe

 Tsy atokisan’ny vahiny intsony, indrindra ny mpizahatany, ny mitsidika an’i Madagasikara. Manjaka ny tsy fandriampahalemana, mipaka any amin’ny fizahantany ny asan-dahalo sy ny famonoan’olona.

Loza mihatra! Vanim-potoana tena mahamaro ny mpizahatany, ankehitriny. Miantraika any amin’ny fizahantany koa anefa ny tsy fandriampahalemana eto Madagasikara, tsy voafehin’ny fitondrana sy ny tompon’andraikitra. Ankoatra ny asan-dahalo, ny fanafihana taksiborosy  amin’ny lalam- pirenena, tafihina sy vonoin’ny jiolahy tsy misy indrafo koa ny mpamily sy ny mpizahatany mandeha amin’ny lalam–pirenena amin’izao fotoana izao. Tato anatin’ny 10 andro, mpamily roa sady mpitari-dia mpizahatany ny namoy ny ainy, novonoin’ny jiolahy teny an-dalana. Maty voatifitra, ny 8 jona teo amin’ny lalana Tsiroanomandidy-Maintirano (RN 1 bis) ny iray, ary ny alahady 17 jona teo, tany Mahabo Morondava ny faharoa.

Nambaran’ny tompon’andraikitra iray amin’ny fikarakarana mpizahatany (tour operateur) eto Antananarivo, manana mpanjifa avy any Soisa sy avy any Alemaina fa nanafoana ny famandrihany ho aty Madagasikara amin’ny volana jolay sy aogositra ho avy izao ny 10%-n’ny mpanjifany vokatry ny tsy fandriampahalemana. « Niezaka nandresy lahatra azy ireo ihany izahay, saingy manahy mafy indray amin’ity famonoan’olona tany Maintirano sy Mahabo ity », hoy ihany izy. Toerana anisan’ny be mpitsidika anefa ny any Menabe, indrindra ny Allée des Baobabs any Morondava mitohy mankany amin’ny Tsingin’i Bemaraha any Belo Tsiribihina».

Manana traikefa ny minisitra vaovao

Vahaolana hentitra sy maharitra ny andrasan’ny vahoaka sy ny sehatra voakasika isan-tsokajiny amin’ity tsy fandriampahalemana ity. Manana traikefa amin’ny fitandroana ny filaminana ny minisitra vaovao ny Fizahantany, Razafitsiandraofa Brunelle, koa antenaina fa hitondra ainga vao amin’ity sehatra ity.

Varotra sy fifandraisana iraisam-pirenena ny fizahantany. Ampiasaina ny fitaovan-tserasera sy ny fifandraisan-davitra ifanakalozam-baovao sy hikarakarana ary anaovana ny famandrihan’ny dian’ny mpizahatany. Koa, azo adika fa tsy maintsy hiantraika amin’ny fifandraisan’i Madagasikara amin’ireo firenena miara-miombon’antoka amintsika ity tsy fandriampahalemana amin’ny fizahantany ity.

Njaka Andriantefiarinesy

News Mada1 partages

Oniversite Mahajanga : nitokona sy nanakan-dalana ny mpianatra

Dila ny roa andro, fetra nomen’ny mpianatra ao amin’ny oniversite Mahajanga ny mpitantana ao an-toerana hamahana ny olan’izy ireo. Niditra tamin’ny fitokonana ny mpianatra omaly. Nisy ny fanakanan-dalana miditra ny faritry ny oniversite. Tsy azo nivezivezena teny an-toerana.

Anisan’ny takian’ireto mpianatra ireto ny tokony hamerenana amin’izy ireo ny fitantanana ny fizarana ny trano fonenan’ny mpianatra. Apetraka amin’ireo fikambanan’ny mpianatra isaky ny fihaviany avy izany fitantanana ny trano fonenana izany.

Nitsipaka ny filazan’ny tompon’andraikitry ny oniversite, ny faran’ny herinandro teo koa ireo mpianatra izay nilaza fa efa tafiditra ao anatin’ny trano fonenana eny an-toerana avokoa ireo mpianatra manodidina ny 1.000 nanao fangatahana hatramin’izay.

Tsy hita tao anatin’ny lisitra navoakan’ny tompon’andraikitry ny oniversite akory ny ankamaroan’ireo mpianatra nanao fangatahana raha ny filazan’ireo mpianatra hatrany.

Ankoatra izay, tsy mbola mahafaly ny mpianatra ny valin’ny conseil de discipline  (Codis) navoakan’ny filankevi-pitantanana momba ireo mpianatra voampanga ho nanakorontana tao amin’ny oniversite farany teo ireny.

Niatrana teny amin’ny oniversite Ambondrona, omaly, ny mpitandro filaminana miandry izay mety ho fihoaram-pefy hataon’ny mpianatra.

Tatiana A

Midi Madagasikara1 partages

Violence envers les enfants à Madagascar: il faut qu’on en parle!

Le lancement officiel des résultats de l’étude sur les violences envers les enfants à Madagascar.

Rapportées ou non par la presse, les violences envers les enfants sont des faits sociaux qui se pratiquent quotidiennement au vu et au su de tous. La situation est d’autant plus inquiétante lorsque lesdits faits sociaux sont considérés comme normaux, minimisés et normalisés….Et ce, au détriment des victimes qui endurent les faits dans le silence et l’ignorance totale. Du côté du gouvernement, des dispositifs tels que les centres Vonjy ont été mis en place pour remédier progressivement à ces problèmes. D’autres initiatives comme les dispositifs de signalement, un numéro vert (144), rejoignent ces efforts. Les acteurs non gouvernementaux ne sont pas en reste. Ils s’activent via des actions de sensibilisation, de vulgarisation de principe, ou encore d’interpellation sur les cas de violence observés.

Les enfants sont considérés comme des sujets passifs et doivent dans ce cas se taire.

Violence envers les enfants: poids de la culture, faits normaux, indifférence. Le lancement du premier rapport d’étude sur la violence envers les enfants qui s’est déroulé à l’Hôtel Colbert Antaninarenina le mardi 19 juin 2018 dernier était l’occasion pour divers acteurs de prendre connaissance de l’ampleur de la situation relative aux problématiques de la violence envers les enfants actuellement. Le rapport dessinait bien sombre tableau de ce qui se fait devant les yeux des Malgaches. Des enfants qui subissent des actes de violence dans leurs foyers, au sein de leurs familles, en milieu scolaire et dans le milieu du travail. Des violences quasi quotidiennes qui sont considérées comme des crimes et qui passent sans que de réelles actions ne soient entreprises par les acteurs. Les discussions qui ont été organisées durant le lancement officiel ont fait ressortir le poids de la culture, en ce qui concerne le genre. «Il faut prendre en compte la notion de genre lorsque l’on parle de violence envers les enfants. Une notion qui trouve tout son sens sur la situation actuelle et qui détermine l’avenir des éventuelles victimes» a-t-on dit. En effet, dans la société malgache, la différence de traitement entre garçon et fille, homme et femme fait que la gent féminine est sommée de se taire, d’endurer et d’être «soumise». Tandis que le sexe masculin est encouragé à s’exprimer et à se faire valoir. Par ailleurs, un point important  également, le fait que la société malgache  considère l’enfant comme étant un «sujet passif ayant avant tout des obligations».

 

La violence envers les enfants est observée dans le milieu scolaire.

Dénoncer, c’est difficile et c’est lourd!. Si le cas de violence se fait donc sur une fille ou une femme, elle (la violence) sera –d’emblée – difficilement observée. Pour le cas de viol sur mineur par exemple, la jeune victime aurait l’attitude – par automatisme – de taire ce qui lui a été fait. Elle (la victime) aura du mal à s’exprimer et à dénoncer l’acte, à cause de la culture ou de la honte. Viennent après les étapes – plus précisément les pressions – des procédures suite à une éventuelle dénonciation qui comprend les enquêtes, la présence des forces de l’ordre, les yeux de la société sur la victime, les séances d’interrogatoires durant lesquelles la victime doit répondre aux mêmes questions et «revivre ce qu’elle a enduré: une agression psychologique, morale et physique». Des étapes qui échappent complètement à une jeune fille qui n’a pas choisi d’être victime, mais auxquelles elle  doit faire face pour qu’on lui «rende justice».

Outre les raisons avancées ci-dessus, la rareté des cas de signalement pourrait également être expliquée par deux niveaux de «soucis». Le premier niveau fait référence à des services publics ne répondant pas aux besoins spécifiques des enfants. Tandis que le second correspond à une combinaison de difficultés et de lacunes au niveau des familles et ménages malgaches. Entre autres des conditions de vie difficiles, la méconnaissance des mécanismes disponibles, le fardeau économique, le peu de confiance que représente le recours à la Justice et le désir de préserver la cohésion sociale.

Une première étude à l’échelle nationale. Le lancement de la première étude relative aux violences envers les enfants devrait permettre à chacun de prendre conscience des réalités et d’agir en conséquence…du moins, c’est ce que l’on attend. En effet, effectuées sur des enfants de cinq  à 18 ans, les violences en question sont observées auprès des familles, en milieu scolaire et dans le milieu du travail.

Des statistiques affolantes. Les chiffres sont alarmants et elles indignent. Plus de 10 000 cas de violence envers les enfants de moins de  cinq  ans sont pris en charge chaque année par les réseaux de Protection de l’Enfant. 17% des jeunes filles de 10 à 17 ans ont été victimes de violences physiques. Toujours dans cette tranche d’âge, 870 jeunes filles ont été victimes de viols et pris en charge dans les centres Vonjy en 2017. 1/3 des décès lors de l’accouchement concerne des adolescentes de 17 à 18 ans. En ce qui concerne les violences sexuelles, 15% des filles de 15 à 19 ans ont été victimes de violences sexuelles et 22,5% des filles de 15 à 19 ans ont été victimes de violences émotionnelles.

D’autres chiffres qui en disent long sur la situation de

2523 personnes interrogées durant l’étude

Près de neuf  jeunes sur dix déclarent avoir été victimes de châtiment corporel au sein de leur famille

Un jeune sur deux dit avoir subi des violences en milieu scolaire

Quatre  enfants sur 10 affirment avoir travaillé avant l’âge de 18 ans

89% des jeunes déclarent avoir été victimes de châtiment corporel dans leur famille, soit près de neuf  jeunes sur 10

65% des répondants considèrent le châtiment corporel comme approprié à la maison

Plus de la moitié des jeunes affirment avoir subi des violences en milieu scolaire, soit un  jeune sur deux

29% des jeunes acceptent le châtiment corporel en milieu scolaire

Pour le travail des enfants, 40% de jeunes affirment avoir travaillé avant 18 ans.

La famille considère les châtiments corporels comme étant juste et utile.

Les recommandations. L’étude menée par l’Unicef et le gouvernement malgache  donne des pistes de réflexion et des suggestions. Répartis sur trois niveaux: elles concernent la politique et la gouvernance, la prévention de la violence et de l’exploitation, le signalement et la prise en charge et le renforcement des capacités.  A cet effet, l’étude suggère l’inscription de la violence dans les priorités nationales de développement,  la fourniture de cadre normatif clair de lutte contre la violence qui serait doté de moyens adéquats ainsi que l’augmentation des ressources dévolues à la protection des enfants contre la violence. Aussi, il serait nécessaire de vulgariser et diffuser les lois y incluant l’obligation de signalement au travers des différents canaux. L’interdiction explicite de  toutes formes de violence physique et psychologique envers les enfants ainsi que la sensibilisation des familles et communautés sur les formes et impacts des violences dans les lieux de travail ou encore du renforcement des mécanismes de contrôle et signalement sont à préconiser. D’autres recommandations font également partie de la liste. Quoi qu’il en soit, la première et la plus importante concerne  l’engagement politique des gouvernants. Une volonté qui devrait être suivie «d’action cohérente, pérenne et bien coordonnée» visant à réduire de façon considérable les cas de violence. Une volonté qui se traduirait par une politique engagée et bien définie qui trace les actions à entreprendre par tous les acteurs, mais surtout qui coordonne les différentes activités desdits acteurs. La dernière et non la moindre, la recevabilité de chaque acteur qui devrait rendre des comptes sur toutes les activités qu’il entreprend dans la lutte contre le fléau. Une recevabilité qui doit couler de source, mais qui fait défaut actuellement.

 Dossier réalisé par José Belalahy

Midi Madagasikara1 partages

Andavamamba : Nifamono ny mpivaro-mandeha, iray maty voatsatoka antsy

Niainga tamin’ny fifamaliana faobe ny zava-nitranga. Mpiray trano ireo vatan-dehilahy maromaro izay raha ny fantatra dia avy any ambanivohitr’Ambatolampy ary tonga mitady vola eto an-drenivohitra. Miompana amin’ny varo-mandeha ny asa fihariana iraisan’ireto lehilahy ireto ary mifanampy izy ireo amin’ny hofan’ny efitrano iray ipetrahany etsy Andavamamba. Betsaka ny zavatra iraisan’ireo olona amin’ny fiainainy andavanandro, satria samy mitovy asa ary koa samy iray  trano fonenana. Rehefa faran’ny herinandro koa dia samy tafaraka ary tamin’ity indray mitoraka ity dia niara-nisotro toaka tamin’ny toerana iray. Teo dia efa nanomboka ny fifamaliana rehefa niakatra ny zava-pisotro mahamamo. Tsy nijanona teo anefa ny sotasota fa mbola nitohy hatrany amin’ny efitrano izay niraisana. Efa samy natory iny indrindra ny rehetra ary noheverina fa efa nilamina ny raharaha. Kinanjo nisy iray nihiaka mafibe tao anatin’ny haizina. Zava-doza no hitan’ny rehetra rehefa nampirehetina ny jiro. Ny iray tamin’ireo lehilahy izay efa nilomano tao anatin’ny rà mandriaka. Teo dia samy nanao izay fomba nitazomana ny ainy ary koa nentina tany amin’ny hopitaly Hjra faran’izay haingana. Efa niala aina izy tonga teny an-toerana noho ny fahaverezan-drà be loatra. Nampandrenesina ny mpitandro ny filaminana izay nanokatra fanadihadiana avy hatrany satria tsy maintsy ny iray tamin’ireo mpiara-monina ireo no tompon’andraikitra tamin’ity vonoan’olona ity.

D.R

Midi Madagasikara1 partages

Conseil départemental de la Réunion : Dans nos murs depuis lundi dernier

Des représentants du Conseil départemental de la Réunion séjournent dans la capitale malgache depuis lundi dernier. Ceci entre dans le cadre de l’intensification de la coopération régionale entre les deux îles. Conduite par le vice- président du Conseil départemental, Daniel Gonthier, la délégation a, durant trois jours, abordé différents secteurs de coopération. A commencer par une rencontre conviviale avec une partie de la société civile, y compris les artistes dont Honty dans la soirée du lundi, puis une séance de réflexion sur la sécurité alimentaire et la promotion de la langue française, mardi dernier. Ce sont le lycée mixte de Zafy Albert (Antsiranana) et le lycée Jean Ralaimongo (Fianarantsoa) qui ont été primés, et bénéficieront d’un séjour en terre réunionnaise.  Et pas plus tard qu’hier, les responsables du Conseil  départemental de la Réunion se sont déplacés à Ambohimangakely, dans le cadre d’un partenariat régional.

Nouveaux projets. Cette délégation entend faire une rétrospective de la coopération entre les deux îles. Et cela, dans l’objectif de tracer de nouveaux projets de coopération visant le développement social, sanitaire et culturel . Les îles de La Réunion et de Madagascar sont en fait liées par l’Histoire et la proximité géographique. Notons que le Conseil départemental de la Réunion a soutenu les forces armées malgaches , dans la prévention et la lutte contre la peste. La délégation prévoit ce mercredi une descente auprès de la mairie d’Ambohijanaka en vue d’un appui matériel à cette municipalité, tenant compte de son importance dans la communauté locale.

Recueillis par Dominique R.

Midi Madagasikara1 partages

IRD- Musée de la Photographie : 70 ans de recherche en images jusqu’au 1er juillet

Aperçu de l’exposition thématique sur l’IRD au Musée de la Photo.

La représentation de l’Institut de Recherche pour le Développement (IRD) à Madagascar s’offre à découvrir, en images, au Musée de la Photographie de Madagascar à Andohalo depuis le 15 mai jusqu’au 1er juillet. Une exposition qui vaut le détour, autant pour le contenu proposé que par l’excellence et le design des infrastructures.

70 ans. Selon les stagiaires déployés sur place pour entreprendre des travaux de médiation culturelle au sein du Musée de la Photographie, cette exposition sur l’IRD a déjà pu enregistrer environ 2000 visites depuis ses débuts à la mi-mai. Au premier étage de cette ancienne Résidence des Maires réhabilitée par le partenariat entre la région Île-de-France et la Commune urbaine d’Antananarivo, les activités entreprises par l’IRD à Madagascar depuis 1946 à ce jour seront synthétisées à travers une exposition thématique et la projection de 12 films documentaires. Historiquement, la coopération entre l’IRD et les scientifiques malgaches a commencé en 1946, quand l’IRD était encore dénommé Office de la Recherche scientifique et technique outre-mer ou ORSTOM. Dans l’exposition thématique, nous pouvons d’ailleurs voir une photo de la délégation de l’ORSTOM, reçue par le Président Tsiranana en 1966.

Projection d’un film sur le « Bilo » en pays Sakalava.

Développement durable. Le contenu de l’exposition, qu’il s’agisse de l’exposition thématique ou de la projection de films, permet au public de découvrir et de comprendre les activités de l’IRD qui sont orientées par la recherche d’un développement durable et humain. Des questionnements économiques- comme le secteur informel, la pêche et la vannerie, ou la riziculture et l’agro-écologie- à la place centrale de la musique dans la transformation des sociétés, en passant par la Santé, la Formation et l’Enseignement, la Biodiversité et les aires protégées, la curiosité intellectuelle du public sera satisfaite. Histoire de se divertir en s’instruisant et de niveler par le haut, en mettant la crise socio-politique entre parenthèses.

Luz Razafimbelo

Midi Madagasikara1 partages

Carnaval de Madagascar : « Tandroy To vatae » s’illustre lors de la 4e édition

Les membres de l’association « Tandroy To vatae », présidée par Rovandratovo Anditeha, lors du grand carnaval de Madagascar samedi dernier.

Présente  depuis le début de l’aventure, l’association présidée par Rovandratovo Anditeha, a longuement et durement travaillé pour pouvoir remporter le premier prix proposé par le Carnaval de Madagascar qui s’est tenu le week end dernier à Mahamasina.

Ils sont la preuve que les efforts finissent toujours par payer ! Présents depuis la première édition du Carnaval de Madagascar, les membres de l’association « Tandroy To vatae », présidée par Rovandratovo Anditeha, ont enfin été récompensés. Dimanche dernier, ils se sont imposés face à leurs concurrents grâce aux tenues et aux shows qu’ils ont proposés et remportent le premier prix proposé par l’Ortana. « Nous avons puisé dans la culture traditionnelle ‘tandroy’. Souvent, quand on parle de notre région, les gens se focalisent sur la famine et la sècheresse, alors qu’il y a tant d’autres choses à voir. A travers notre prestation, on voulait montrer au public, aux Tananariviens et aux touristes en particulier, que nous méritons l’attention, non parce que les gens de chez nous ont un quotidien difficile, mais parce que nous avons une très belle culture qui peut être un levier de développement. L’objectif de notre association est d’ailleurs de faire de l’Androy la nouvelle destination touristique. Et au cas où les gens se poseraient la question : non, nous n’entrons aucunement dans les choses politiques. Nous n’avons qu’une seule mission : faire en sorte que notre région se développe ». La diversité culturelle était le thème pour cette quatrième édition.Mahetsaka

Midi Madagasikara1 partages

« Fara West » : Noro Andrianasolo dans son répertoire favori !

Les semaines dédiées aux artistes femmes se poursuivent en beauté au « Fara West » Faravohitra. Ce samedi, c’est une autre voix, une autre couleur toute en nuances latinos sur un répertoire éclectique qui sera sous les feux des projecteurs. Noro Andrianasolo, les mélomanes la connaissent certainement, même si elle n’est pas de celles qui sont  toujours sur le devant de la scène. La musique a toujours bercé son enfance et c’est naturellement qu’en 1984, elle s’intègre au groupe Dadah Rabel des « Mahaleo » avec lequel elle s’est produite sur de nombreuses scènes de l’Hexagone. Elle prend goût aux chansons à textes, se met à composer. Noro sera accompagnée de son mari Solo Andrianasolo à la guitare, poly-instrumentiste, jazzman, ainsi que de Faly Rakotondrainibe à la batterie, Jacques Ramiara à la basse. Vous la retrouverez donc dans son répertoire favori : le latino. Ses propres compositions, des balades suaves, harmonieuses qui vous envelopperont pour un voyage en apesanteur complèteront le tout. Noro Andrianasolo  dans son répertoire favori, à découvrir et à apprécier sans aucune modération… c’est ce samedi 23 juin au « Fara West » à 20 heures.Mahetsaka

Midi Madagasikara1 partages

ATSIMO ANDREFANA : Toliara Fetim-pirenena, tsy marisika manangan-tsaina ny mponina

Mariky ny fiandrianam-pirenena sy ny fitiavan-tanindrazana ny fananganan-tsaina rehefa fankalazana ny fetin’ny 26 jona tahaka izao, kanefa dimy andro mialoha ny fankalazana fetim-pirenena malagasy, dia mbola vitsy an’ isa ny tokantrano eto Toliara no manangan-tsaina. Raha tsiahivina, dia “Fitiavan-tanindrazana sy filaminana antoky ny fampandrosoana ho fisandratran’i Madagasikara” no lohahevitry ny fankalazana amin’ity taona ity, ary ny alatsinainy 4 jona teo no tokony nanomboka ny fananganana sainam-pirenena isan-tokantrano, sekoly miankina sy tsy miankina amin’ny fanjakana, biraom-panjakana, lapam-panjakana arahina fiaraha-miredona ny hiram-pirenena no hisantarana ny fankalazana ny Faha-58 taonan’ny fahaleovantem-pirenena sady fetin’ny foloalindahy rahateo. Raha ny fanamarihana nataona raiamandrenibe iray tsongoim-bolo an-tanàna, dia mariky ny tsy fahakasitrahan’ny vahoaka ny mpitondra azy ny maha vitsy ny olona manangan-tsaina, satria mbola sahirana (tsy manana fahaleovan-tena ara-tsakafo, ara-bola, tany, fanafody, . . . ) ny ankamaroan’ny Malagasy dia leo disadisa politika, ary olom-bitsy no mihanoka sy mitavana ny harem-pirenena eto, ka izany no antony mahatonga ny ankamaroan’ny olona tsy marisika manangan-tsaina intsony, indrindra  tamin’ity taona 2018 ity izay hitakian’ny maro ny fialan’ny filoham-pirenena, hoy izy. Amin’ny ankapobeny, raha ny fanadihadiana natao, dia mbola mangina tanteraka ihany koa ny tsenan’ny sainam-pirenena, harendrina, akanjo, kilalao, akoho amam-borona, . . . , araka ny resaka nifanaovana tamin’ireo mpivarotra.

Eric Manitrisa

Midi Madagasikara1 partages

Lutte contre l’insécurité ; Le premier défi du P.M.

On aurait voulu ne plus en parler. Mais le problème se pose toujours avec la même acuité et il est en train de détruire lentement et sûrement cette cohésion, fondement de notre société. L’insécurité est présente  sur l’ensemble de notre territoire. Tout en traumatisant la population, elle donne une image peu reluisante de notre pays et elle est en train de mettre à mal ce secteur du tourisme, vecteur important de notre développement.

Lutte contre l’insécurité ; Le premier défi du P.M.

Les interpellations des autorités ont été faites plusieurs fois dans les médias et les responsables au  plus haut niveau de l’Etat ont affirmé qu’ils étaient conscients de la gravité de la situation. Le chef de l’Etat, lui-même, avait dit qu’il faisait de la lutte contre l’insécurité une priorité. Le  Premier ministre de l’époque  avait fait la même promesse. Les réunions des différents états- majors se sont multipliées et on a parlé de plan bien mûri pour éradiquer ce fléau . L’opinion a pris acte des assurances données. Les actes de banditisme et les razzias de « dahalo »  ont continué. Les citoyens dans les grands centres urbains  n’ont pas été plus rassurés, les attaques à main armée se multipliant. Les kidnappings de ressortissants  « karana » ont repris de plus belle. Les taxis- brousse  sont devenus des cibles privilégiées de bandes organisées. Ces dernières, aujourd’hui, s’attaquent  aux convois de touristes et des chauffeurs- guides ont, ces derniers jours, payé de leur vie cette nouvelle tactique utilisée par les détrousseurs. Aujourd’hui, cela été rapporté à l’extérieur et notre réputation est gravement entachée. Le secteur du tourisme en a pâti, de  nombreux étrangers ayant annulé leurs réservations auprès des agences de voyages. Les autorités qui ont été saisies ont décidé de prendre des mesures drastiques. Le  chef du nouveau gouvernement semble ne plus vouloir tergiverser, car c’est un des premiers grands problèmes auquel il  est confronté. Tout le monde l’attend au tournant.

Patrice RABE

Midi Madagasikara1 partages

Mahazoarivo : Le FMI et la Banque mondiale chez Christian Ntsay

Coralie Gevers, la Représentante résidente de la Banque mondiale et Patrick Imam, le Représentant résident du FMI, hier, à Mahazoarivo.

Les visites de courtoisie se suivent mais ne se ressemblent pas à Mahazoarivo. Ainsi, le Premier ministre Christian Ntsay a reçu quelques diplomates, hier matin, entre autres Harald Gehrig, l’Ambassadeur d’Allemagne, Mohamed Abdallah Cherif, le Responsable-Pays de la Banque Africaine de Développement (BAD), Philippe Brandt, l’Ambassadeur de Suisse, Coralie Gevers, la Représentante résidente de la Banque mondiale et Patrick Imam, le Représentant résident du FMI. La venue de représentants des opérateurs économiques du GEM (Groupement des Entreprises de Madagascar), conduits par leur présidente,  Madame Soanorondriaka Joséphine Andriamamonjisoa, a également marqué la journée d’hier.

Recueillis par Dominique R.

Midi Madagasikara1 partages

Soins palliatifs : Encore inconnus du public

Les soins palliatifs concernent surtout les patients atteints du cancer.

Utiles, voire nécessaires, les soins palliatifs aident considérablement  les malades tels que les cancéreux pour  faire face – dans un minimum de «confort» – à leur souffrance.

Existant, mais ignoré par le  plus grand  nombre  des citoyens. Propos qui résument la situation relative aux soins palliatifs dans la Grande Ile. Consistant à prendre en charge les malades souffrant de douleurs physiques, psychologiques et morales, les soins palliatifs ont existé dans les divers services de santé malgaches  depuis, sans que les patients en soient au courant. Comme l’a fait savoir  Dianarivo Rasoanambininjanahary, Directrice nationale de l’ONG « Douleur sans frontières » lors de la conférence sur les soins palliatifs et douleurs à Madagascar au Centre hospitalier universitaire Joseph Ravoahangy Andrianavalona Ampefiloha hier: «  Les soins palliatifs ont toujours existé, mais il n’y a pas vraiment eu de coordination des activités y afférentes». La directrice de l’ONG « Douleur sans frontières » de noter qu’il incombe à chaque médecin de faire «le nécessaire pour limiter les douleurs de chaque patient».

Diplômés. L’organisation de la conférence au CHU JRA Ampefiloha hier a donc voulu faire en sorte de réunir le plus de participants émanant de différents horizons possibles (ministère de la Santé, médecins libres, étudiants et journalistes) pour «trouver comment faire en sorte de développer la qualité des soins en question. Mais surtout pour trouver comment coordonner les activités afin de faciliter la prise en charge des patients». Présente dans la Grande Ile depuis 2008 et outre la conférence d’hier, l’ONG « Douleur sans frontières » a pu initier une collaboration avec la faculté de médecine de l’Université d’Antananarivo afin de mettre en place une formation spécialisée en matière de soins palliatifs. «Il y a actuellement 26 médecins diplômés en soins palliatifs éparpillés dans toutes les régions du pays» a-t-on fait savoir. La sélection serait restrictive et axée sur la qualité des intéressés. Ce, afin de produire les  «meilleurs médecins aptes à prendre en charge les patients qui ont besoin des soins adéquats». Il convient de noter que l’initiative de la mise en place d’une formation spécialisée en la matière aurait été poussée par le fait que les soins palliatifs ne figurent pas dans le cursus universitaire auprès de la faculté de médecine de l’université d’Antananarivo.

 

José Belalahy

Midi Madagasikara1 partages

SOCIO…..….SCOPIE

Education physique et sportive. Les épreuves d’Education physique et sportive (EPS) dans le cadre du Brevet d’Etudes du Premier Cycle (BEPC) 2018 ont débuté depuis le 18 juin dernier pour les régions Melaky et Bongolava.

Etudes anglophones. Le club « The First Toastmasers Club of Madagascar » (ou premier club de toastmasters de Madagascar) a été enfin institué au Centre culturel américain à Tanjombato. Il s’agit d’un dispositif mis en place pour apprendre à parler en public dans la langue de Shakespeare. Localement, l’initiative « The first Toastmasters Club of Madagascar » est mise en œuvre par le Ministère de l’Education nationale et l’Ambassade des Etats-Unis à Madagascar. Par ailleurs, notons que les « Toastmasters Club » existent déjà aux quatre coins du monde.

Environnement. Depuis le week-end dernier, une étude d’impacts socio-environnementaux du projet de construction de la digue visant à protéger la ville de Manakara a débuté dans la région, dans l’Atsimo Atsinanana. Une délégation du Ministère de l’Environnement, de l’Ecologie et des Forêts est en action sur place.

Changement climatique. Selon un communiqué de la Banque mondiale datant du 13 juin dernier, les financements des projets de lutte contre le changement climatique, octroyés aux pays en voie de développement ont connu une hausse de 30% en 2017 par rapport à l’année 2016. Provenant de banques multilatérales, comme de fonds climatiques, ces financements ont atteint 35,2 milliards de dollars. Un record historique. Le même communiqué de citer que l’Amérique latine, l’Afrique subsaharienne et l’Asie de l’Est et le Pacifique, régions particulièrement vulnérables aux effets du changement climatique, ont été priorisées dans l’octroi de ces financements.

Recueillis par Luz Razafimbelo

Madaplus.info0 partages

Crash d’avion à Ampangabe: un comité technique mis en place

L’enquête sur les raisons du crash de l’avion de la compagnie MTA à Ampangabe Ambohitrimanjaka est en cours. Un comité technique composé de l’ACM, d’une cellule mixte d’enquêtes spécialisée, de l’armée, et de l’ASECNA a été mis en place.
Pour rappel, l’avion de type PA31 Navajo immatriculé 5R-MKF a connu un terrible sort lundi 18 juin en se crashant à Ampangabe Ambohitrimanjaka. Les 5 occupants de l’appareil ont tous péri suite au crash. Le but de la mis en place de ce comité est de déterminer la ou les raison(s) de cet accident. Il va recueillir les témoignages de ceux qui ont pu voir le déroulement du crash, l’épave de l’avion fera l’objet d’une expertise. Une fois toutes les informations reçues, elles seront données aux forces de l’ordre pour une enquête approfondie.
Madaplus.info0 partages

Casseurs de vitesse sur les voies rapides : source d’accident ?

Ce n’est pas la première fois qu’on entend qu’un scooter ou une voiture a fait un accident en passant par des casseurs des vitesses dans les voies rapides à Antananarivo. Pas plus tard que cette semaine, une voiture a été endommagée en se crashant dans un canal du bas côté de la route suite à des casseurs de vitesse du by-pass (voie rapide reliant la route nationale 2 et route nationale 7).
Manque de signalisation : des fois, il n’y a pas de signalisation pour prévenir les usagers de la route de l’existence de ces casseurs qui entrainent ces accidents. En outre, parfois, les casseurs sont mis du jour en lendemain et les habitués de la route sont surpris.
News Mada0 partages

Taranja iraisana : miroborobo ny sekolin’ny basikety ao Toamasina

Miroborobo  tanteraka.  Mbola taranja  voalohany be mpankafy eto Toamasina ny basikety. Manoloana izany, nametraka paikady ireo andriambavilanitra, efa nitondra ny lazan’ i Madagasikara teo amin’ny taranja  basikety teo amin’ny sehatra iraisam-pirenena. Zary lasa  hifaninanana ny fananganana sekoly ho an’ny ankizy eo amin’ny  fampianarana sy fitaizana amin’io  taranja io amin’izao fotoana izao. Efa anjatony izao ny ankizy mpianatra manaraka fanazarantena isaky ny alarobia sy asabotsy tolakandro etsy amin’ny kianja malalaky DRJS, Tanamakoa.  Mitarika izany Rakotozafy  Sabine, kalazavavy, teo aloha ao amin’ny klioban’ny AS Port, ary efa nilalao tao  amin’ ny Ascut. Tahaka ny fianarana rehetra ihany  ny sekoly tantanany. Misy ny saran’ny fampianarana sy ny fitaizana ny ankizy amin’ny lafiny  rehetra, indrindra amin’ny maha fanatanjahantena azy.

Sajo

News Mada0 partages

4e art : la musique fêtée dans l’allégresse

La Fête de la musique va faire le plein de décibels,  ce jour, aux quatre coins de la capitale, à l’occasion de laquelle une ribambelle d’artistes compte bien célébrer le 4e art dans toute sa diversité. Tour d’horizon.

Faites de la musique ! Effectivement, la Fête de la musique est célébrée dans une centaine de pays chaque 21 juin, à travers des festivals, des concerts «indoor» et «outdoor».  Antananarivo, comme le reste du pays, ne dérogera pas à cette fête populaire.

«Ampy daty», qui se traduit en d’autres termes par «mis à jour», envahira ce jour la rue Rainitovo d’Antsahavola. L’escalier menant à Antaninarenina a été rénové, par des artistes peintres locaux, pour accueillir un spectacle d’art vivant mais également et surtout une prestation musicale. Deux scènes seront érigées sur lesquelles vont se relayer Rainitelo, BM, Jao Mpiarakandro, Andry Milay, Silo, Holly Zion, Rolf Miangaly, Beool et Naty Kaly.

Lien social

L’IFM s’associera à cet événement d’envergure mondiale qui célèbre cette année sa 37e édition. Les lieux seront investis par Fanaiky Quartet, Olo Blaky et Matsubara. La musique du monde et le reggae retentiront dans la joie et la bonne humeur au Jamaïca Chill, tout au long de la soirée, avec Mafonja et le jeune groupe Rapo Atlas. «Ce sera la deuxième fois que nous fêtons la musique sur scène. Depuis, nous, le groupe, avons partagé la même conviction que la musique, bien plus qu’une expression artistique, est un vecteur de lien social et d’échanges et d’éducation. Etant un bon moyen de se rassembler et de communier, elle peut casser beaucoup de barrières», argumente le meneur du groupe Rapo Atlas.

Libertalia-Music Records sort le grand jeu en mettant sur le même plateau LohArano, No Mady et Kristel dans «Rock’ N Galz» au Kristel au Kudéta Urban Club Anosy.

Joachin Michaël

 

News Mada0 partages

Fiaramanidina nianjera : nitsangana ny kaomisiona mpanao fanadihadiana

Mbola tsy mazava ny anton’ny loza nahatonga ny fianjeran’ilay fiaramanidina kely teny Ampangabe. Manokatra fandihadiana ny manampahaizana manokana ka asa raha ahita mangirana.

Nitsangana ny kaomisiona manokana hisahana ny fanadihadiana momba ilay fiaramanidina kely an’ny MTA nianjera tany Ampangabe, ny alatsinainy teo, ka nahafaty olona dimy. Komitin’ ny teknika manokana avy eo anivon’ ny tafika, ny ACM, ny « Cellule mixte d’enquêtes spécialisées », ny Asecna ny hiandraikitra ny fanadihadiana mikasika ny fienjeran’ ity fiaramanidina kely ity.Eo am-panadihadiana ny olana mety nahatonga iny loza iny ireto komity teknika ireto amin’ izao fotoana izao. Mandeha ny ahiahy ny amin’ny mety hoe lany solika na nidiran’ ny vorona ny « hélice » ka nitera-doza, sns. Tombantombana ihany anefa ireo fa ny tohin’ny fanadihadiana ny ahafantarana ny tena marina. Olana ny tsy fisian’ny “boite noire” amin’ny karazana fiaramanidina kely tahaka itony. Rehefa latsaky ny sivy ny isan’ny toerana ao aminy, tsy misy an’io fitaovana io. Anisan’ny mampanano sarotra ny fanadihadiana izany.Eo ihany koa ny fakàna am-bavany ireo olona nahita ny nitrangan’ ny loza. “Rehefa azo avokoa ny vaovao rehetra, aravona iray ary hiditra amin’ ny famotorana lalina ny vondron’ ny mpitandro filaminana avy eo”, hoy ny fanazavana.

Raha tsiahivina kely, ny alatsinainy tokony ho tamin’ny 9 ora sy sasany maraina ny nitrangan’ny loza. Nihodinkodina toy tandrimo izy io ary nianjera avy eo. Olona dimy indray maty tamin’izany ka mpianatra manamory fiaramanidina, zazalahilkely 15 taona, ary jeneraly iray maty tamin’izany. Andrasana ny tohin’ny fanadihadiana.

Yves S.

News Mada0 partages

Fetin’ny 26 jona : nampiseho ny fahaiza-manaony ny Foloalindahy

Niavaka ny fankalazana ny fetin’ny 26 jona 2018 tamin’ity taona ity ho an’ny fianakaviamben’ny Foloalindahy. Nampiseho ny fahaiza-manaony manokana izy ireo indrindra ny fifehezana ny fitaovam-piadiana mahery vaika, toy ny basy, ny tafondro, ny fiara mifono vy, ny helikoptera teny amin’ny Kianjaben’i Mahamasina, omaly tolakandro ireo hery vonjy taitra eo anivon’ny Foloalindahy Malagasy. Nisantatra izany ny hery vonjy taitra eo anivon’ny polisim-pirenena (USI, Sag, UIR) izay nampiseho ny fiatrehan’izy ireo manokana ny ady amin’ny asan-jiolahy mitam-piadiana mahery vaika sy ny fomba fiatrehana mandritra ny fifanenjehana amin’ireny olon-dratsy ireny. Taorian’izay, nampiseho ny fahaizany manokana koa ireo bemoto eo anivon’ny zandarimariam-pirenena mandritra ny fisavana ireny fiara mifamezivezy eny an-dalambe ireny indrindra rehefa misy mitsoaka tampoka. Teo koa ireo zandary mitaingin-tsoavaly ary ireo alika mpitsongo dia. Namarana izany ny tafika tamin’ny alalan’ireo vondron-tafika manokana, nampiseho ny fiatrehana amin’ny asan-dahalo any amin’ny faritra mena.

J.C

News Mada0 partages

Tsy fandriampahalemana RN 4, RN 6 : mampiaka-peo, mandrahona hitokona ny mpitatitra

Efa nirongatra, saingy vao mainka miha-mahery vaika ny tsy fandriampahalemana amin’ny lalampirenena, hatramin’ny nametrahana irony ”casseur de vitesse” irony. Mampiaka-peo, mandrahona hitokona noho izany, ireo mpitatitra, indrindra ireo mpampiasa ny RN 4 sy RN 6. Mitaky ny hanalana izany, ao anatin’ny 72 ora izy ireo.

Manoloana ny fanafihana taksiborosy, hatramin’ireo fiara ampanofaina mitondra mpizahatany, nampiaka-peo ny mpitatitra mampiasa ny lalam-pirenena fahefetra mampitohy an’Ambondromamy sy Antsiranana. Manambana ny hanao fitokonambe izy ireo amin’izany. Voalazan’izy ireo fa anisan’ny mahatonga ny asan-jiolahy ny fisian’ireo “casseurs de vitesse” amin’ireo lalam-pirenena ireo. Mihena ny hafainganam-pandeha, tsy maintsy mandeha mora ka hararaotin’ny jiolahy. Manome 72 ora ny tompon’andraikitra mahefa izy ireo hanalana ireo “casseurs de vitesse” rehetra amin’ireo lalana ireo.

Na ny eto an-dRenivohitra aza, isehoan’izany, toy ny eny amin’ny Rocade, mampitaraina ny olona maro. Vao nametrahana ihany koa ny eny By Pass, izay nitera-doza sahady omaly alina. Andrasana izay fepetra raisin’ny fitondrana manoloana ireo rehetra ireo.

Takisborosy roa voatafika, voakapa famaky ny mpamily roa

Nisehoana fanafihana taksiborosy tany amin’ny lalam-pirenena fahefatra, teo amin’ny toerana antsoina hoe Andriba, kilaometra vitsivitsy miala an’i Maevatanana, omaly manodidina ny tamin’ny 12 ora alina. Nosakanan’ireo jiolahy tamin’ny vatan-kazo ny lalana-ka tsy afa nandeha ireo taksiborosy roa avy any Ambanja. Nivoaka avy anaty haizina ny jiolahy manodidina ny 10 teo ka nanatona avy hatrany ny mpamily. Nokapain’ireo tamin’ny famaky ny tanan’ireo mpamily roa lahy. Tsy nahetsika ny mpandeha rehetra nanoloana izany ka norobain’ireo olon-dratsy avokoa. Vola, finday sy entana samy hafa lasan’izy ireo tamin’izany. Nidify tanaty hny aizina ireo mpanafika taorian’izay.

Nisy ny fiara nandalo taorian’izay ka namonjy ireo naratra, sady nampandre ny zandary. Tonga teny an-toerana ny zandary avy any Maevatanana ary nanao ny fanadihadiana avy hatrany. Nisy ny fanarahan-dia ka voalaza fa efa nisy ny olona voasambotry ny zandary tamin’izany. Mandeha ny famotorana raha anisan’ireo mpanafika ireo tratran’ny zandary.

Yves S.

 

News Mada0 partages

Sina-Madagasikara : 40 hiofana momba ny harena an-kibon’ny tany

Manamafy ny fiaraha-miasa i Sina sy i Madagasikara eo amin’ny sehatry ny harena ambanin’ny tany. Nosokafana, omaly, teny amin’ny Conficius Ankatso, ny fanofanana momba ny fandalinana ny teknika fitrandrahana ny harena an-kibon’ny tany.  40 ny hanaraka izany fiofanana izany ka 35 avy ao amin’ny minisiteran’ny Harena an-kibon’ny tany sy ny solika, dimy ny avy amin’ny SVT Ankatso. Tsy atoro izao tontolo izao ny traikefan’ny Sinoa amin’ity sehatra iray ity, indrindra tao anatin’ny 60 taona.

Harena voalohany anefa ny olona koa ny fanomezana azy ireo ny fahalalana bebe kokoa ny harena misy eto an-tanindrazana, hahazoana manombana, hahafantarana ny tahiry misy. Nampahatsiahy ry zareo Sinoa fa efa tamin’ny taona 2016, nahavitana sarintany ny tontolon’ny harena an-kibon’ny tany eto Madagasikara. Maro ihany koa ireo orinasa sinoa nanao fikarohana, anisan’izany ny nataon’ny Wisco, ny taona 2010, tany Soalala, faritra Boeny, fikarohana momba ny vy.

Ny minisitra Rabary Njaka Henri sy ny filohan’ny oniversiten’Antananarivo, ny Pr Ramanoelina Panja, samy nilaza ny maha zava-dehibe izao fanofanana izao. Mpamatsy vola ny fanjakana sinoa ; mpikarakaraka ny minisiteran’ny Harena voajanahary sy ny fikarohana any Sina miaraka amin’ny minisiteran’ny Harena an-kibon’ny tany sy ny solika eto an-toerana. Manampy azy ireo ny Bureau d’enquête géologique de Chine (China Geological Survey-CGS), manome ny mpampiofana sy ny oniversiten’Antananarivo.

R.Mathieu

News Mada0 partages

Herisetra : mahatsiaro mijaly ny ankamaroan’ny ankizy any an-tsekoly

Miseho amin’ny endriny maro ny herisetra mianjady amin’ny ankizy. Mahatsiaro mijaly izy ireo na tsy miteny vokatr’izany. Andraikitry ny tsirairay ny miady amin’izany herisetra izany.

Raha ny tatitra navoakan’ny mpanao fanadihadiana avy amin’ireo fikambanana mpiaro ny zon’ny ankizy, mbola betsaka ny fampijaliana ankizy eto Madagasikara. Miseho amin’ny endriny maro izany.

Ankizy sivy amin’ny 10 no mahatsiaro fampijaliana eo anivon’ny ankohonany. Kapoka, levilevy, teny ratsy… Ankizy iray amin’ny roa kosa milaza fa iharan’ny herisetra any an-tsekoly. Mety hataon’ny mpampianatra izany fa mety ho avy amin’ny samy ankizy ihany koa indraindray.

Ankizy efatra amin’ny 10 kosa, manamafy fa miasa sahady mamelona ny ankohonany na tsy mbola feno taona akory aza. Voaterin’ny tsy fisiana na irahin’ny ray aman-dreniny mihitsy izy ireny.

Misy fiantraikany ratsy amin’ny fivoaran’ny ankizy ny herisetra mianjady aminy. Ny sasany maratra, mangana na mety hitondra kilema sy takaitra mihitsy aza. Mampikorontana ny fivoarana na saina na vatana na fihetseham-po ho an’ny ankizy ihany koa ny herisetra mianjady aminy.  Mety hitarika amin’ny fitondrantena mivaona sy tsy voafehy ihany koa ny akon’ireny herisetra ireny. Lasa mitarika ny ankizy hanana fahatanorana mandringa na sarotra entina ary lasa mpanao herisetra ihany koa.

Ankoatra izany ny mety hampiala an-daharana ny ankizy any an-tsekoly. Eny, mety hitarika hatramin’ny fahafatesan’izy ireo aza amin’ny famoizam-po na fandratrana sy famonoana tafahoatra.

Miankina amin’ny tsirairay araka izany ny ady amin’ny fanafoanana ny herisetra mianjady amin’ny ankizy. Voalohany amin’izany ny famolavolana azy ireny miainga ao an-tokantrano izay ampitain’ny ray aman-dreny. Na fomba fiteny na fihetsika na fijery misy dikany avokoa ary mila voalanjalanja tsy hahery setra.

Mitohy eo anivon’ny fiarahamonina ny fitaizana ny ankizy sy ny fanaraha-maso azy tsy hiharan’ny herisetra. Toraka izany ny any am-pianarana, mandany ny ampahany betsaka amin’ny andavanandrom-piainany.

Mila mahasahy miteny ihany koa ny rehetra rehefa mahita trangana herisetra mahazo ny ankizy na aiza na aiza toerana ahitana izany.

Tatiana A

News Mada0 partages

Chronique : digression footballistique

On manifeste, on fait la grève, on menace, on vocifère… mais entre deux manifestations, on n’oublie pas la Coupe du Monde de football. D’ailleurs, vous n’aurez pas manqué de faire le rapprochement entre nos crises pré- ou post- électorales et la grande fête du sport le plus populaire du monde : elles reviennent avec la régularité d’une montre. Elles se ressemblent, à ceci près qu’on a tout de même plus de plaisir à regarder un match de football, même quand on vocifère devant les maladresses ou la mauvaise foi d’un joueur.

A côté de l’engouement toujours renouvelé pour le ballon rond, une remarque revient à chaque match que dispute l’équipe du pays qu’on adore détester, comprenez l’équipe de France. On l’appelait l’équipe black-blanc-beur à l’image d’un pays qui, depuis le dernier quart du siècle dernier, décline sa citoyenneté dans la diversité des couleurs de la peau.  Vingt ans après le triomphe de la dream team française, on laisse échapper un ricanement chaque fois que les Bleu-Blanc-Rouge sont en lice en notant qu’il n’y a pas beaucoup de vrais Français dans cette équipe.

«On», ce sont les nostalgiques d’une France monochrome, dignes héritiers de ceux qui trouvaient qu’il y avait trop d’espingoins, de ritals ou de polaks dans le doux pays de France. Mais à des années-lumière de la France dite de souche, «on», c’est nous, qui oublions trop souvent que si nous sommes autochtones, nos ancêtres sont tous venus de quelque part au-delà des mers et que nous sommes issus de leur métissage.

Qui sont les vrais Français, qui sont les vrais Malgaches ? Voilà des questions que nos voisins Mauriciens ne se posent pas. Après avoir évalué la citoyenneté mauricienne, certains dirigeants du dragon de l’océan indien sont prêts à la concéder, moyennant un million de dollars le papier qui fera de l’étranger un Mauricien taratasy. Même si nous aimons beaucoup les Mauriciens, ne nous sentons pas obligés de leur voler cette très mauvaise idée.

Retournons plutôt devant nos écrans, regardons le football et en prime, de vrais Sénégalais.

Kemba Ranavela

News Mada0 partages

Hevitra mandalo Resaky ny mpitsimpona akotry : sotro iray ho an’ny tsirairay

Tsy hita alaina sary an-tsaina akory izany olona mamaha-tena amin’ny sotro roa izany. Na tendan-kanina toy ny inona aza, misy fetra ny tsy fanajan-tena. Asa izay tena hevitr’ireo antoko sady nanaiky hanana solontena ao

amin’ny governemantan’i Christian Ntsay no mbola tsy nametraka teny midina ho an’ireo depiote misalotra ny lokony mikasika ny fitsaharana amin’ny fandraisana anjara eo amin’ny hetsika etsy amin’ny Kianja 13 mai. Marina fa mbola tsy tafita an-tsakany sy an-davany ny valin’ireo fangatahana rehetra, nefa ny fahatazanana fankatoavana ankilany, porofon’izany ireo namana niara-nijoro efa nanaiky hipetrapetraka any amin’ny ministera, ary tsy fankatoavana andaniny noho ny fijoroana eto an-kalamanjana, dia mampiroaroa ny sain’ny mponina.

Ho an’ny mpitazana ny fanaovana na fanohizana hetsika an-dalambe mitory tsy fankatoavana, izay mifanipaka amin’ny fandraisana anjara ao anatin’ilay rafitra vaovao napetraka ho famahana ny olana. Raha tsy fanaovana fahagagana izy ity ka isehoana no sady ao anatiny no any ivelany. Fitiavana fisabakana izany, sao mitresaka eo ny elakela-pe ! Very hevitra ny mpitazana, lany fitokisana ny olona.

Misy anefa ny tanjona mazava, ny fahamaikana ny fanatanterahana faran’izay haingana ny fifidianana. Izany anefa tsy ho tratra raha toa tsy mahafehy ny filaminana ny mpitantana. Tsy mitovy hevitra amin’izany anefa ny tarik’ireo teo amin’ny fitondrana irery teo aloha, dia ny Filoha sy ny HVM.

Eo amin’izay enefa, izany hoe fametrahana ny fotoana anaovana ny fifidianana no tena vaindohan-draharaha. Tsy misy fady fa izao fitapitaka sy sikidy mila voa-tsiary rehetra izao dia hita atao fitaovana ho fanemorana ny fotoana.

Iza moa no tsy resy lahatra fa ny fifidianana no hany làlana ahafahana mivoaka avy ao anatin’ity olana ity ? Ny fanafohezana volana roa ny fe-potoana anjakan’izy ireo ve no tsy foiny ho an’ny tombotsoam-pirenena ? Ny fanohizana ny hetsika etsy amin’ny 13 mai rehefa ela ny ela, na tsy nahy aza mety hifototra amin’ny tena ka ho voalazany ho firaisan-tendro aminy, amin’ny filazany hoe “jereo kely anie ho porofon’ny tsy fandrian’ny tany ny hetsika lavareny eo amin’ny Kianja 13 mai”. Toy ny fanomezana basy hitifirana ny tena ny fanohizana ny hetsika.

Tsy milaza anefa izany fa tokony hajanona ny tolona. Tsy maintsy mailo lalandava ny mponina. Ny mpilalao pôlitika mantsy dia iaraha-mahafantatra fa samy te hijijy baolina arak’izay hahasalama azy ka mila arahi-maso daholo na ireo mpiray dia amin’ny tena aza.

Léo Raz

 

News Mada0 partages

Madagascar il y a 100 ans

Tournée d’inspection

Le Général Commandant supérieur Nicolle s’est rendu à Majunga à l’effet d’aller inspecter les postes militaires de la côte ouest. Il s’est embarqué à Majunga sur le Léon Saury à destination de Basalampy puis, prenant la voie de terre, est remonté vers le nord pour visiter Bokarano ; ensuite, se dirigeant vers le sud, il a inspecté les postes de Bekodoka, Kandreho, Tsiandro, Maintirano, Malaimbandy, Morafenobe et est arrivé à Antsirabe. Là, il a pris l’automobile pour Tananarive. Dans cette tournée, il était accompagné de M. le Directeur du Service de Santé Camail et du Capitaine Bleusez. Il s’est montré satisfait du bon fonctionnement des divers services militaires, a témoigné la plus haute bienveillance aux officiers et sous-officiers qui dirigeaient ces postes, et s’est intéressé à la condition morale et matérielle des militaires européens et indigènes, les interrogeant sur leur position sociale, leur état de santé et leurs précédents militaires. Cette tournée laissera un profond souvenir aussi bien chez les Européens que chez les indigènes de ces régions-là, car il y avait longtemps qu’on n’avait vu un général passer par là ; ce n’est, en effet, qu’avant la guerre, en 1913, que le Général Riou avait accompli une tournée suivant le même itinéraire.

Avis

L’Administrateur des Colonies, Chef de la Province et Maire de Tamatave, a l’honneur de porter à la connaissance du public le télégramme suivant qui lui a été communiqué par M. le Directeur des Magasins Généraux et qui est susceptible d’intéresser le commerce local :

«On offre fret Tamatave-New York par un voilier deux mille tonnes à 65 dollars tonne cubique assurance tous risques huit pour cent consul Amérique signale comme produits demandés par États-Unis cuirs, bois ; pensons que chargeurs pourraient profiter occasion pour charger cuirs rebutés par Intendance également bois dont chargement difficile pour Métropole ; syndicat interviendrait pour faire évacuer par côtiers des ports secondaires sur Tamatave ; prière indiquer si exportateurs seraient disposés charger ; communiquez. Syndicat chargeurs.»

Le Tamatave

www.bibliothequemalgache.com

 

News Mada0 partages

Us et coutumes : ce n’est pas grave, on répète…

Discipline, un deux, un, deux… On répète pour le grand raout du 26 juin. Non, en réalité, on se prépare pour la répétition, ça compte donc presque pour du beurre. Alors voilà : on porte la tenue et les chaussures et on marche, alignés trois par trois… enfin presque ; on va dire qu’on marche ensemble. Pour la ligne parfaite, il n’y a pas le feu, on peut attendre le grand jour. Et comme c’est la répétition de la répétition, on peut aussi s’octroyer une petite cigarette, histoire de passer le temps pendant la marche. Ne vous inquiétez pas pour le grand jour, on sait bien qu’il serait malvenu de cracher ses poumons devant tout le gratin. Alors on le fait maintenant, devant les quidams. C’est plus sage, non ?

 

News Mada0 partages

Fiaraha-miasa amin’ny ONG DSF : azo ampitoniana amin’ny fitaovana manokana ny fanaintainana

Amin’izao fotoana izao, misy fomba roa azo hanafoanana na hanalefahana ny fanaintainana miseho amin’ny vatan’ny olona rehefa tsy salama. Manana toeram-pandraisana ny aretina manaintaina ny hopitaly HJRA eo anivon’ny foibe nasionaly miady amin’ny fanaintainana (CNLD), araka ny fanazavan’ny mpitantana ny foibe nasionaly eto an-dRenivohitra, Rasoanambininjanahary Tianarivo, omaly teny Anosy. Ahitana foibe toy izany koa any amin’ny Hopitalibe ao Toamasina sy ny hopitaly Androva ao Mahajanga. Azo alana amin’ny fampiasana fanafody ny fanaintainana indrindra ho an’ny aretina homamiadana, aretina mpahazo ny hazondamosina, ny tsimokaretina VIH/Sida…

Eo koa ny fitsaboana ny fanaintainana tsy mampiasa fanafody fa misafidy ny fitaovana « neuro stimulation éléctrique trans-cutané » mampitony izany. Tapahina amin’ny fametrahana ity fitaovana ity amin’ny vatana ny fanaintainana ka mpitsabo ihany no manana fahaizana hikirakira azy. Azo ampiasaina amin’ny aretina rehetra ny fitaovana ka ora iray ny faharetany hatao intelo isan-kerinandro. Amin’izao fotoana izao, 10 ny fitaovana ampiasain’ny foibe eto Antananarivo vokatry ny fiaraha-miasa amin’ny ONG Douleurs sans frontiers (DSF) nanomboka ny taona 2015. “Mahatratra 15 ka hatramin’ny 30 ny marary manaraka fitsaboana ao amin’ny foibe ka zaza 5 taona ny zandriny indrindra”, hoy ny mpiandraikitra ny fitsaboana, Randriamisaina Isthman. Maimaimpoana ny fitsaboana fa tsy maintsy manatona ny foibe ireo mila fikarakarana.

 300 euros ny vidin’ilay fitaovana

Mahatratra 300 euros ny vidin’ity fitaovana fampitoniana ny fanaintainana ity ary mbola hafarana any ivelany fa tsy misy eto Madagasikara. Ankoatra ny fametrahana ity fitaovana ity amin’ny vatana, fomba iray hafa koa ny “hypnoanalgésie” manodina ny sain’ny marary tsy hifantoka amin’ny fanaintainana fa hitodika amin’ny tontolo hafa mahafinaritra. 5 mn ka hatramin’ny 30 mn ny faharetan’ny fandraisana. Tanjon’ireo fomba roa ireo ny fampihenana ny fanafody ampiasaina hanalefahana ny fanaintainana amin’ny vatan’ny olona.

26 ny mpitsabo manokana

Andiany roa ahitana mpitsabo manokana 26 no efa nivoaka teny amin’ny fakiolten’ny fianarana ho mpitsabo (oniversiten’Antananarivo) ka mahafehy ny fandraisana an-tanana ny fanaintainana sy ny fitsaboana mampitony. Mbola manohana ny fanofanana koa ny ONG DSF. 10 taona ny fiaraha-miasan’ny ONG sy ny minisiteran’ny Fahasalamana nanomboka ny taona 2009.

Vonjy A.

News Mada0 partages

Éducation : le niveau des étudiants régresse

Jérôme Rasoloarimanana a été, hier, l’invité de l’émission « Ambarao » de la radio Alliance92. Ce philosophe et non moins phénoménologue y a évoqué les problèmes de l’éducation à Madagascar, dont le niveau des étudiants actuels.

Une régression du niveau des étudiants est observée depuis 2008, par rapport à leurs ainés, notamment pour les bacheliers, a affirmé Jérôme Rasoloarimanana,. « La faille est que les étudiants actuels ne sont ni scientifiques, ni littéraires, Cela résulte d’une carence de l’orientation des études universitaires ». De souligner qu’« il arrive que certains étudiants se trompent même de filière. L’important est ainsi pour eux de décrocher uniquement  un diplôme ».

Il a également évoqué l’âge des étudiants, en moyenne de 16 ans à 18 ans pour la première année. Un âge où il est encore difficile d’affronter les études supérieures, qui ne se limitent pas seulement au transfert des savoirs mais qui, surtout, exigent des recherches.

Un défaut d’assistance

Ce phénoménologue a également souligné l’importance de la méthodologie d’enseignement, répartie en trois catégories, à savoir l’enseignement théorique, les travaux dirigés et l’horaire des étudiants. Or, il s’avère que des professeurs ne tiennent pas trop en compte ces trois principes, négligeant ainsi la réceptivité des étudiants qui sont en face d’eux, vu leur âge. « Ils se contentent tout simplement de dispenser des cours, pourtant, l’assistance et les suivis des étudiants sont toujours nécessaires pour un appui fondamental de leur évolution », a-t-il rappelé. Afin de renforcer leurs compétences et leur autonomie dans leurs études, surtout au niveau des recherches, l’approche interactive a ainsi été avancée par Jérôme Rasoloarimanana comme solution.

Un LMD inopportun

Concernant le système LMD, Jérôme Rasoloarimanana a mentionné que sa mise en place est un peu en avance, donc inopportune. « Un tel système nécessite toujours des mesures d’accompagnement, comme l’utilisation des Tics et surtout, des compétences pédagogiques des enseignants », a-t-il indiqué. Ce qui n’est pas toujours le cas pour certains étudiants, si on ne parle que de l’accès aux Tics. « C’est mettre la charrue avant les bœufs, et celui qui est censé les conduire se trouve derrière et ne voit pas le chemin à parcourir », a-t-il conclu.

Sera R.

News Mada0 partages

Syndrome de la mule : une Bolivienne arrêtée

  Une Bolivienne a été interpellée à l’aéroport international d’Ivato, dimanche dernier, par la douane malgache. 70 capsules de drogue doivent être extirpées de son corps.

Sur la base de renseignements fiables, les agents de la douane malgache ont interpellé une mule bolivienne à l’aéroport d’Ivato, ce jour-là, dans l’après-midi. Elle venait de débarquer du vol Airlink en provenance de Johannesburg.

Les bagages du suspect ont été passés au scanner mais les résultats s’avéraient négatifs. Pour en avoir le cœur net, les douaniers ont repassé la vérification de ses bagages à la main, mais toujours sans  résultat.

Les douaniers ont alors décidé de soumettre la suspecte à un scanner corporel à l’hôpital. Les résultats ont confirmé la présence de plusieurs capsules dans son ventre, dans l’utérus et dans le gros intestin. La Bolivienne a déclaré avoir avalé 70 capsules, dont une partie a déjà été évacuée.

ATs.

News Mada0 partages

Exposition : plus que quelques jours pour «Sublime»

Depuis le début de ce mois jusqu’au 30 juin, neuf peintres exposent à l’hôtel Le Louvre à Antaninarenina. Il s’agit de  Petit Maître, Benjamin Raharijaona, Mahenina, Naivo Haja, Arthur, Mistery, Dolph, D’ange et Suzy, la seule femme. «Nous avons choisi de nommer l’exposition Sublime, parce qu’en fait, nous dévoilons toutes nos œuvres sublimes réalisées ces derniers mois», a expliqué un des artistes. Chacun a son propre style. Si certains présentent des œuvres en aquarelle, pour les autres, les leurs sont à l’huile. «Par ailleurs, nous utilisons des médiums différents, tels que des écorces de bananiers, vitre…», a-t-il continué.

Ces neuf peintres ont déjà l’habitude d’exposer ensemble, la plupart du temps, au Tahala Rarihasina. Par ailleurs, ils sont membres du collectif appelé 13e colline, composé d’une trentaine d’artistes. «Au mois de juillet prochain, nous allons inaugurer un espace spécial pour la peinture, une sorte de galerie qui se trouve au jardin d’Andohalo», a ajouté le peintre dénommé Petit Maître.

«Par ailleurs, nous sommes actuellement en pleine préparation d’un autre projet plus grandiose avec une association étrangère appelée Marque Madagascar. Une autre galerie, que nous allons surnommer 13e colline, s’ouvrira bientôt à Ambatovinaky Imarivolanitra», a-t-il affirmé.

Holy Danielle

 

News Mada0 partages

Rugby scolaire : Satrokala brille de mille feux

Le championnat de la région du sud-ouest accouche d’une nouvelle championne : l’équipe de Satrokala. «Cette qualification valide le travail pédagogique mené par Hélène Olivia et Marco Aimé Rakotoniaina durant toute l’année au sein de Rugby Academy Ihorombe», a communiqué l’association «Terre en mêlées», organisatrice de l’événement.

Premier des cinq joutes régionales qualificatives pour le championnat national du rugby scolaire, la compétition qui s’est déroulée à Toliara la semaine dernière sera suivie de celle du sud-est, à Fianarantsoa, du 6 au 8 juillet.

Ainsi de suite, des nouvelles équipes rejoindront le chemin menant au championnat national à l’issue de chaque joute régionale.

Naisa

La suite du programme :

Sud-est à Fianarantsoa : 6-8 juillet

Nord-est à Toamasina : 20-22 juillet

Nord-ouest à Ambanja :

3-5 août

Hauts-plateaux à Antananarivo : 20-22 septembre

 

News Mada0 partages

Foot – ligue des champions : les premiers coups de sifflet vont retentir

Les duels des Champions marqueront les esprits en football. Les équipes qualifiées abordent la première phase de la ligue des Champions ce vendredi. Cette campagne inaugurale ne prendra fin que le 1er juillet.

La succession à la Cnaps Sport est lancée ! A l’issue des championnats régionaux, 24 équipes ont obtenu leur ticket pour la plus prestigieuse compétition nationale des clubs parmi lesquels figurent les Caissiers, champions en titre.

Ces derniers, après une campagne régionale mitigée, semblent plus prenables que lors des autres saisons d’autant plus que pour cette phase inaugurale, ils évoluent loin de leur base, à Mahajanga, dans le fief de Fosa Junior.

De quoi faire saliver les amateurs de ballon rond de la Cité des Fleurs qui auront le privilège d’assister à un combat entre ces deux équipes favorites du groupe A lors de la dernière journée. En attendant, elles vont devoir prouver leur statut face aux champions des autres régions du groupe.

Ce sera également le cas dans les trois autres groupes où les formations considérées comme fortes vont devoir le montrer sur le terrain au risque de suivre le pas des mondialistes, tels les Allemands ou encore les Brésiliens, qui ont rencontré des difficultés dans leur entrée en lice.

Parmi elles, l’équipe championne d’Analamanga et non moins vice-championne de Madagascar en titre, Elgeco Plus, qui évolue dans le groupe C.

Equilibré

Il semble, au vu de la composition des équipes par groupe, que, contrairement aux groupes A et C, ceux de B et D sont bien équilibrés. Toutes les formations ont presque les mêmes opportunités de briller. Seules les expériences des grands rendez-vous manquent à certaines d’entre elles par rapport à d’autres, suffisantes pour faire basculer une rencontre à ce niveau de la compétition.

Naisa

Programme de la 1ère journée :

Groupe A :

Tam Port-Bergé-Cnaps Sport

Fosa Junior-FC Maeva

FC Metal-Jaolahin’Iharana

Groupe B:

MTM-Racing Soma Beach

FC Léopard-Ascoimi Mahanoro

FCA-Ajesaia

Groupe C:

FC Rabaza-Jet LMada

FC Vakinankaratra CUA-FC Olympique

FC AZ-Elgeco Plus

Groupe D :

Akon’Ambatomena-AS Espoir

FC Manjaka-FC VFM

3FB-Fils d’éléphants

Ino Vaovao0 partages

SAMBAVA : Toeram-pisotroana iray voatafiky ny jiolahy, lasa ny vola ariary 15 tapitrisa

Tafaporitsaka ireo olon-dratsy rehefa nikaikaika niantso vonjy ilay ramatoa vadin’ny  tompon-trano izay samy Sinoa avokoa izy ireo. 

Tsy nanampo ireo jiolahy fa nisy fakantsary miafina tao anatin’ilay toeram- pisotroana ka hita tao amin’ilay horonantsary avokoa ny fihetsik’izy telo lahy nirongo basy, nanafika ireto. Raha ny vaovao azo dia fanaon’ireo mpampiasa ny mandefa ny mpiasa hody rehefa tapitra ny ora voafaritra hiasany ka matetika ireo mpanjifa farany izay mbola misakafo na misotro farany dia izy mivady tompon-trano sisa no miandry azy ireo. Kinanjo fa tamin’io alatsinainy io dia nisy telo lahy nisotro farany tao ka nakaton’ilay mpivarotra ny varavarana. 

Tsy niandry ela akory fa avy dia nidaroka tampoka ilay sinoa lehilahy ny iray tamin’izy ireo, ny roa kosa nitsofoka tany amin’ny efitrano fatorian’ireto farany. Novakian’ireo olon-dratsy ny toerana fampirimam-bola ka norobain’izy ireo avokoa ny vola rehetra tao anatin’ izany, izay mitentina ariary 15 tapitrisa. Nandritra izany anefa tafavoaka ny trano ilay ramatoa ka niantso vonjy. Rehefa azon’izy ireo ny vola dia lasa nitsoaka avy hatrany ireto farany. 

Tsy misy ahiana ny ain’izy mivady ireo ankehitriny ary efa manao ny asany ny mpitandro filaminana any an-toerana mikaroka ireo jiolahy nahavanon-doza. Mana mora ny asan’ireo mpitandro filaminana amin’ny fikarohana ireo olon-dratsy ny fisian’ilay horonantsary.

Pounie

Ino Vaovao0 partages

AMPAREMAHITSY - MAHAJANGA : Nahitana fatin-dehilahy efa simba sy tsy misy ahafantarana azy tao anaty ala

Tao anaty ala no nahitana azy. Mpangady vovo teo akaiky kosa no nahare fofona hafahafa ka nizaha ny manodidina, ka tamin’izay no nahitany ilay razana. Nampilaza ny sefo fokontany avy hatrany izy taorian’izay. Ity farany indray no namory fokonolona nijery ilay razana. 

Tsy misy ahafantarana ity lehilahy ity intsony satria efa lanin’ny olitra tanteraka ny tarehiny. Azo antoka, hoy ny dokotera avy amin’ny Bmh fa novonoina ity olona ity, ary maro ny manaporofo izany. Efa andro maromaro no nahafaty azy io. Manoloana izany kosa dia nandray fepetra ny fokonolona hamono lamba ny razana sy handevina azy eny amin’ny Croisement Boanamary, hanajana ny maha olona. Manao antso avo kosa izy ireo ho an’izay very havana mba hanantona azy ireo.

Fatin-dehilahy sahabo ho 37 taona hita nihantona tao Ambohimandamina

Teo amin’ny varavarana vy no nahitana ny fatin’ity lehilahy iray 37 taona teny amin’ny fokontany Ambohimandamina, sektera fahafito.  Ny alin’ny alahady tamin’ny firavan’ny baolina farany no nahitan’ny olona an’i Tabé nihantona, rehefa nody tao an-trano izy ireo. Tany amin’ny manodidina ny tamin’ny 9 ora sy sasany sy tamin’ny folo ora alina tany ho any no heverin’ny olona ho nanantonany ny tenany.

Olona salama saina tsara izy io ary tsy dia manana olana loatra. Ny omalin’io aza dia mbola nisangisangy tamin’olona hafa izy ary tsy nitaraina ho manana olana. Tsy manambady izy saingy manan-janaka ary tsy miara-mipetraka aminy io zanany io. Efa noraisin’ny fianakaviany an-tanana kosa ny fandevenana azy.

Vanessa

Ino Vaovao0 partages

SEMPAMA : Ahemotra daholo ny datim-panadinana rehetra eran’i Madagasikara

Fanapahan-kevitra tsy maintsy noraisina io satria efa iray volana mahery no tsy nianatra ny mpianatra eran’i Madagasikara, hoy izy. Ny sendika dia mametraka hatrany fa tsy maintsy mihemotra ny datim-panadinana, araka ny fana zavany. Lavabe ny taom-pianarana tamin’ity, hoy izy 11/12 raha 9/12 no tokony ho izy.

Efa misy fotoana azo  izany saingy tsy maintsy ahemotra ihany ahafahan’ny ankizy manao fanadinana. Nametraka ihany koa anefa izy ireo fa tsy hiverina hampianatra mihitsy raha tsy mahazo fahafaham-po amin’ny fitakiana ataony. Ary rehefa mahazo fahafaham-po ka miverina any an-tsekoly vao manapa-kevitra ny daty hanemorana ny fanadinana. 

Manambara moa izy ireo fa raha tsy mahazo fahafaham-po dia tsy hiverina hiasa mihitsy izany hoe ahiana ny hisian’ny taona fotsy amin’ity taona ity. Mametraka mantsy izy ireo fa tokony tafiditra amin’ny “loi de finances rectificative” ny tombontsoa takian’izy ireo. Amin’izao fotoana izao anefa dia mbola betsaka ny fandaniam-bolan’ny fanjakana Malagasy, toy izay ny vola miditra amin’ny kitapom-bolam-panjakana. 

Trosa sy findramam-bola no amenoana ny banga. Vitan’ny fanjakana foana anefa izany ho an’ny mpiasam-panjakana sasany ary misy mihitsy ireo mahazo tombontsoa mihoa-pampana raha mitaha amin’ny mpiasam-panjakana hafa ka mampisy hantsana eo amin’izy samy izy.  Ny efa nahazo tombontsoa anefa tsy hanaiky raha hanombinana ny azy, ka ho hita eo ihany ny tohiny.

Vanessa

Ino Vaovao0 partages

FANAFIHANA TAO MANANARA-AVARATRA : Olona iray voaheloka 5 taona an-tranomaizina

Raharaham-pitsarana mitondra ny antotan-taratasin’ady laharana 60-Toa/2017. Raha tsiahivina, dia jiolahy miisa 5 no nanafika tokantranona mpandraharaha ara-toekarena iray tao Mananara-Avaratra ny 2 jona 2015 io. 

Ny telo, dia azon’ny fokonolona sambo-belona ka samy matin’ny fitsaram-bahoaka avokoa. Ny roa kosa tafaporitsaka saingy voasambotry ny zandary taty aoriana na dia niezaka niafina tany anaty ala aza. 

I Rakotondramanana io voasambotry ny zandary io. Izy izay anisany voatondro ho nandray anjara tamin’ilay fanafihana mitam-piadiana tao Mananara-Avaratra roa taona lasa izay. 

Teo anoloan’ny fitsarana, niezaka niaro tena ny voampanga tamin’ny filazana fa ny famakiana takamoa teo ivelan’ny tranon’ilay olona notafihina no anjara asany fa tsy niditra tao an-trano velively ny tenany. 

Tsy nandaitra tamin’ny mpitsara mpamoaka didy izany fiarovan-tena izany, na teo koa aza ireo fanazavana nataon’ny mpiaro ny voampanga.

Taorian’ny fotoana fohy nandinihan’ny mpitsara sy ireo mpitsara mpanampy ny fehezan-dalàna famaizana, dia nilatsaka ny didy mavesatra ho an-dRako tondramanana. Voaheloka hanao asa anterivozona 5 taona an-tranomaizina sy tsy fahazahoana manitsaka faritany mandritry ny 5 taona ny tenany.

Kamy

Ino Vaovao0 partages

TAMPON-TANANA ANTALAHA : Notapahin’ny Jirama ny jiro ao amin’ny seranam-piaramanidina

Tamin’ny ora nanoratanay izao dia mbola tsy niverina ary tsy haverin’ny orinasa raha tsy voaloa ny faktiora 5 volana, araka ny loharanom-baovao. Noho ny zava-miseho dia miantso ny tompon’andraikitra mba hamaha ny olana ny mpiasa ao an-toerana, mba hisorohana ny loza mety hitranga raha misy sidina mandeha ao amin’ny seranam-piaramanidina ao Antalaha.

Ankoatra izany dia mananosarotra ny fitandroana ny ain’ny olona amin’ny fifamoivoizana anabakabaka satria tsy misy fifandraisana azo atao. Raha ny loharanom-baovao ihany dia tsy mbola nisy tao an-toerana ny trangan-javatra na fanapahan-jiro nataon’ny Jirama tahaka izao. Nanamafy ny tompon’andraikitry ny orinasa Jirama fa tsy hamerina ny jiro raha tsy voaefa ny faktiora.

Pounie

Ino Vaovao0 partages

ONIVERSITEN’I MAHAJANGA : Mitaky fifampiresahana amin’ny mpitantana ireo mpianatra

Tsy manka sitraka ary mandà tanteraka ny fanapahan- kevitry ny mpitantana momba ny fizarana trano ireo mpianatry ny oniversite sasany eto Mahajanga. Tsy vahaolana intsony, hoy hatrany izy ireo ny fanalana mpianatra efa anaty trano fa fandaminana no tokony hatao.

Tsy ekena ny hevitra sy tetika hampisara-bazana ny firaisan kinan’ny mpianatra, hoy ny mpitondra teny ka mangataka fifampiresahana ahafahana mikatsaka sy mijery vahaolana maharitra sy mety hiatrehana ity taom-pianarana ity. 

Mitaky ihany koa ny fanafoanana ny valin’ny Codis koa izy ireo, izay mametraka moa fa misy mpianatra vitsivitsy tsy afaka hianatra raha tsy amin’ny taona ho avy. Hianatra ny dian’izy ireo aty, hoy izy ireo ka tsy ekeny izany fanapahan-kevitra izany. Mitaky sy miandrandra fifampiresahana hatrany izy ireo.

Vanessa

Tia Tanindranaza0 partages

Fampandrosoana ny toekarenaIlaina fifehezana mafy hahatrarana ny tanjona

Mitohy hatrany ny fahapotehan’ny toekaren’i Madagasikara. Tsy mbola milamina ny savorovoro politika misy ary hita ho mitohy hatrany ny grevy sy ny tsy fanekenan’ireo sendika maro ireo minisitra sasantsasany napetraka.

Tsiry

 

 

Tia Tanindranaza0 partages

Fampitoniana ny fanaintainanaEfa manana ivontoerana afaka mandray izany i Madagasikara

Tsy misy aretina tsy mandalo fanaintainana. Saika miaina sy misedra izany avokoa ny marary rehetra, antony nijoroan’ny ivontoeram-pirenena misahana ny fanaintainana etsy amin’ny hopitaly HJRA Ampefiloha.

Pati

 

 

Tia Tanindranaza0 partages

MPIVARO-MANDEHA NIFAMONO

Nifamono ny mpivaro-mandeha ka tao anatin’ny maizina no nisehoan’izany. Miara-mipetraka ao amin’ny efitrano iray hofain’izy ireo miaraka ny olona avy any Ambatolampy.

 

 Nisy ny fifamaliana rehefa samy mamomamo ary efa samy natory no nisy nitrena mafy be tao anatin’ilay toerana. Rehefa narehitra ny jiro dia olona efa voatsindron’antsy teo amin’ny kibony no hita. Efa niala aina izy tamin’ny fotoana nahatongavany teny amin’ny hopitaly ary maty ihany na natao aza ny ala nenina. DIDIM-POITRA TSY NETY

 

Misesy indray ny zazalahy entina eny amin’ny toeram-pitsaboana mba hanavotana ny ainy rehefa avy natao didim-poitra teny amin’ny « rain-jaza ». Very ra ireo zaza noho ny afitsoky ny ady gasy. Misy ny avotra ary ao kosa no efa tara loatra vao tonga eny amin’ny mpitsabo izay mamerina avy hatrany ny fandidiana ary mamatotra ny lalandra mba hijanonan’ny ra mandriaka. Mbola mitazona ny fomba nentim-paharazana ny Malagasy saingy tsy nanaraka kosa ny fivoarana ara-pitsaboana izay nisy. Ankehitriny mantsy dia efa tsy tokony hisy ra latsaka intsony ny didim-poitra moderna. ROLLY MERCIA

 

Miparitaka amin’ny tambajotra sosialy ny halatra bevava nataon’i Rolly Mercia fony izy minisitra, mahakasika ny fandefasana ny lalao Mondial amin’ny TVM. Voamarika fa vola 250.000 euros no nahodiny, raha araka io fijery io, avy amin’ny fanazavan’ny ORTM fa ny antsasaky ny lalao amin’ny Mondial no azo halefa satria izany ihany no nahazoana fifanarahana. Rehefa nojeren’ny mpandinika akaiky anefa dia hay lalao nalaina tamin’ny fahitalavitra Free-To-Air ary maimaimpoana ireo alefa eto amintsika ireo. Izany hoe nakepoka izany ny volabe, raha mitombina tokoa io fanazavana io. FANAFIHANA TAKSIBROSY RN 4

Vao maraina omaly dia efa voaroba ny taksibrosy nanao andiany tamin’ny lalam-pirenena fahefatra. Lehilahy tsy latsaky ny folo ary mitazona basy no nanao ny fanakanan-dalana. Fiara roa no tena voamarina fa voaroba tanteraka, lasa ny volan’ny mpandeha sy ny entany. Mba tsy nisy ny aina nafoy na dia nidaroka aza ireo lehilahy mitam-basy. Tsy mandry intsony ny fahalemanana amin’ny lalam-pirenena rehetra eto amintsika. Mizaka izany hatrany ny olom-pirenena ary raha ny fantatra dia efa mikononkonona grevy ny mpitatitra ato ho ato.  LOZAM-PIFAMOIVOIZANA ENY AMIN’NY BY PASS

 

Araka ny efa nahian’ny mpampiasa lalana dia nitera-doza tokoa ilay « casseur de vitesse » napetraka tetsy By-Pass mifanandrify amin’Ambohimangakely. Fiarakely Golf iray no nanitsaka an’izany tao anatin’ny fandehanana mafy ary koa tao anaty maizina ary nivadika tanteraka. Naratra ny olona nentiny saingy mba avotra soa aman-tsara avokoa. Etsy an-daniny, mikasa ny hitokona ny mpitatitra noho ny fametahana ireny « casseur » ireny eny amin’ny lalam-pirenena fahefatra sy fahenina kanefa tsy misy fepetra mifanaraka amin’izay toy ny fanamarihana sy famantarana manokana ary ahiana hitera-doza marobe.

 

VOLA HANAOVANA FETY

 

 Marobe ny prefektiora mitaraina sy mitaintaina sahady amin’izao ankatoky ny fetin’ny fahaleovantena izao. Ny antony dia noho ny tsy fahatongavan’ny vola avy amin’ny fanjakana tokony hanatontosana ny fety isan-karazany. Voatery mindram-bola na mifampiraharaha amin’ny sehatra tsy miankina ny prefe. Ireo farany anefa dia mailo satria ny tamin’ny herintaona aza tsy voaverina ny vola hatramin’izao. ATAO FANADIHADIANA NY MTA

 

Hampiantsoana eny amin’ny mininisiteran’ny fitaterana ary hanaovana fanadihadiana ny kaompania MTA, orinasa tompon’ny fiaramanidina nianjera tetsy Ampangabe. Raha ny fantatra hatreto, fiaramanidina anisan’ny ratsy indrindra an’io kaompania io ity nampiasaina ity ka nitera-doza nahafaty olona dimy. Mipetraka hatrany ny fanontaniana raha mbola azo ampiasaina ilay fiaramanidina. Maninona no tsy mba nisy « parachute » mihitsy tao anatiny kanefa sidina nanaovana fanofanana. Fantatra koa fa ilay jeneraly nanamory dia io no sidina farany tokony ho nataony mba nahazoany ny fahafahana mampiofana any aoriana. Dia tena sidina farany tokoa ho an’ny fiainany no nitranga.MBS

 

Ao anatin’ny andrana teknika ankehitriny ny onjam-peo MBS. Efa manomboka miverina tsikelikely ny fandaharana ao anatiny. Mazava izany fa efa misy ny fifanarahana ambadika ary anisan’ny notakian’ny TIM ny fanokafana an’ity onjam-peo ity ary tokony hoeken’ny minisitry ny serasera vaovao. Tsy mbola fantatra kosa ny momba ny fahitalavitra MBS izay andrandrain’ny maro ny hisokafany, indrindra amin’izao ankatoky ny fifidianana izao. Mitodika tanteraka amin’izay fanapahan-kevitra etsy Nanisana (minisiteran’ny serasera) ny maso ankehitriny. MPIRAKI-DRAHARAHAN’NY FITSARANA

 

 Nanapa-kevitra ny sendikan’ny mpiraki-draharaha ny nampiato vonjimaika ny tolona nataon’izy ireo. Ny filazany fa misy fampanantenana avy amin’ny minisitry ny fitsarana ny amin’ny fitakian’izy ireo no antony. Tsy midika anefa izany fa hijanona tanteraka ny tolona fa miankina amin’izay fiovana azo tsapain-tanana avy amin’ny minisiteran’ny fitsarana.

 

OLONA NAMETRAKA BAOMBA

 

Avy amin'ny alalan'ny sary tamin'ny "vidéosurveillance" ary koa ny fitsirihina ny antso an-tariby no nahafahana nisambotra ny tompon'andraikitra tamin'ny fametrahana baomba sy fampihorohoroana tao amin'ny Galerie Smart Tanjombato. Olona efatra no efa eo am-pelatanan'ny zandary ankehitriny. Voasokajy ho mpampihorohoro izy ireo tao anatin'ny vesatra fiampangana.

 

 

 

Tia Tanindranaza0 partages

MadagasikaraNy 40 %-n’ny ankizy no miasa alohan’ny faha-18 taonany

Miisa iray miliara ireo zaza roa ka hatramin’ny 17 taona no fantatra fa hiharan’ny herisetra maneran-tany ka tafiditra ao anatin’izany ny fampiasana azy ireo mialoha ny faha-18 taonany.

 

MISEHO AMIN’NY ENDRIKA MARO 

 

Miseho amin’ny endriny maro ny fampiasana zaza tsy ampy taona eto amintsika. Ho antsika eto an-drenivohitra dia ireo ray aman-dreny mihitsy amin’ny ankapobeny no mampaniraka ny zanany hanao izany mba hahazoany vola, ankoatra ireo efa kamboty. Tsy mbola zakan’ny sain’ny ankizy anefa ny miasa satria tsy miantoka ny fivelarany sady mety hanimba ny hoavy iray manontolo mihitsy. Misy amin’izy ireny ny manao tsianjery dia mangataka avy eo izay ahazoany vola 2.000 Ar isaky ankizy isan’andro raha kely indrindra. Toraka izany koa ireo mitaona rano maloto izay ahazoana 100 Ar isaky ny sceau iray  mandroso sy miverina raha mbola mijanona ho 10 ka hatramin’ny 15 Ar kosa ny mitaona biriky iray, miankina amin’ny halaviran-dalana. Ny 80%-n’ireo ankizy monina eny amin’ny faritra iva dia saika manao ireo asa ireo avokoa. Ho an’ny any amin’ny faritra indray, indrindra fa ny any avaratra dia ny fitangosana lavanila no tena asa hataon’izy ireo izay mety hahazoany 100.000 Ar isaky ny ankizy isan’andro, antony mahafoana tanteraka ny mpianatra eny anivon’ny EPP rehefa  fotoam-piotazana. Saika miafara amin’ny fanararaotana ara-nofo avokoa anefa ny ankamaroan’ireo tranga ireo amin’ny ankapobeny. Ny 15 %-n’ireo zazavavy kely 15 ka hatramin’ny19 taona no efa lasibatra.

 

SADY MIANATRA NO MIASA

 

Misy amin’ireo ankizy efa miasa  ireo no mbola mianatra ihany koa, indrindra  fa ireo  mipetraka aman’olona na koa manan-jandry marobe  ka tsy maintsy manampy amin’ny fidiram-bola ao an-tokantrano. Ho ana sekolim-panjakana iray eto an-drenivohitra, ohatra, dia miisa folo eo ho eo ireo ankizy voakasika. Tena mahay tokoa ny ankamaroan’izy ireo, hoy ny talen-tsekoly saingy ny olana dia diso reraka amin’ny fitadiavana izy ireo ka tsy mifantoka amin’ny fianarana intsony. Matory avokoa ny ankamaroan’izy ireo rehefa tonga any an-tsekoly raha misy ireo marary vokatry ny havizanana mihitsy. Mbola zon’ny ankizy anefa ny mianatra, misakafo ara-dalàna,  manana fianakaviana saingy tsy ahitana taratra izany intsony ny fiainantsika eto Madagasikara ankehitriny. Ankizy enina  amin’ny folo  no tsy tafiditra eny anivon’ny EPP intsony noho izay fampiasana azy izay raha iray amin’ny 2 no lasibatry ny tsy fanjarian-tsakafo.

 

HENJEHIN’NY LALANA

 

Marihina anefa fa henjehin’ny lalana ny fampiasana zaza tsy ampy taona, indrindra raha latsaky ny 15 taona izy ireny. Tsy mihoatra ny 8 ora isan’andro, ohatra,  ny ora hampiasana ilay ankizy dia maka aina mandritra ny 12 ora,   hiantohana ostie raha marary, mahazo sakafo ara-dalàna, mandray karama ihany koa, ary nahazoana alalana tsara avy amin-dray aman-dreniny ny fampiasana azy araka ny artikla faha-100 voasoratra ao anatin’ny lalàna mifehy ny asa. Raha vao latsaky ny 15 taona ny zaza iray dia mety mampigadra ny fampiasana azy ireny, indrindra raha mbola arahina karazana herisetra toy ny fikasihan-tanana sy ny tsy fanomezana sakafo izany. Miankina amin’ilay zava-misy niainan’ilay zaza anefa ny sazy mety hahazo ilay mpampiasa, araka ny artikla laharana 261 voasoratra ao anatin’ny lalàna mifehy ny asa. Miainga amin’ny 1 ka hatramin’ny 3 tapitrisa Ar ny onitra aloha amin’izany izay mety hiampy fidirana am-ponja iray ka hatramin’ny telo taona mihitsy raha tsy voahaja ireo voalaza etsy ambony ireo.

 

ANKIZY  MIVARO-TENA

 

Anisan’ny asa ataon’ny ankizy betsaka ihany koa eto amintsikany fivarotan-tena an-tsokosoko. Efa hatramin’izay no nisy io, hoy ny ECPAT. Miisa folo ireo hitany  lasibatry ny vohoka tsy niriana  hatramin’ny taona 2009 no ho mankaty, raha 5 ireo efa raisiny an-tanana eto an-drenivohitra ankehitriny. Fomba efatra no entin’ny ankizy mivaro-tena ankehitriny eto amintsika ka 16 taona no kely indrindra amin’izy ireny. Lohalaharana ny fijorojoroana etsy sy eroa, any amin’ny karaoke, any amin’ny efitrano fanorana, izay nomarihiny fa efa manana mpanjifa manokana mihitsy, ary any anaty  tambajotram-pifandraisana. Noho ny rendrandra amin’ny ankapobeny no manosika ny ankizy hanao ilay asa toy  ireo te hampiasa finday avo lenta, te hanao fitafiana miavaka amin’ny an’ny hafa, te-hihinana sakafo be… ka ny fivarotany ny tenany no hitany fa vahaolana. Misy ihany koa anefa ireo teren’ny tsy fisiana lava ao an-trano, kamboty na koa manana olana amin’ireo nahitany masoandro.

 

 

 

POLITIKAN’NY FANJAKANA

Efa manana ny politika hahafahana miady amin’ny herisetra mahazo ireo ankizy latsaky ny 18 taona eto amintsika ny fitondram-panjakana. Hampitomboina ho 8 % izay mitentina 7.000 miliara Ar ny tetibola entina hanatsarana ny fiainan’ny ankizy amin’ny ankapobeny ( fahasalamana, fianarana, sakafo…) raha 15 %  no neken’i Madagasikara nandritra ny fifanarahana iraisam-pirenena  momba ny fanajana ny zon’ny ankizy izay nanaovantsika tamin’ny taona 1991. Manohana akaiky izany ny birao iraisam-pirenena momba ny asa izay manofana arak’asa ireo ankizy any amin’ny faritra mba hahatonga azy ireny tsy hanaotao foana. Anisany ny any Antsiranana izay misy ireo andiana ankizy fôrôsy.

 

Pati

Tia Tanindranaza0 partages

Mondial 2018Famintinana ny herinandro nifaninanana

Herinandro katroka anio alakamisy 21 jona izay no nanombohan’ny Mondial 2018 tontosaina any Rosia. Lalao 20 izay no vita ary baolina niisa 45 no tafiditra tamin’izany ka ny 3 tamin’ireo dia penality azo tamin’ny VAR na ny « Arbitrage vidéo ».

 

Tia Tanindranaza0 partages

Basket-Ball MalagasyHotontosaina miaraka eny Ankatso ny 3X3 sy 5x5

Raikitra indray ny fifaninanana nasionaly Basket 3X3 "ASIO TELO ANY E" sokajy Sénior lehilahy sy vehivavy ary sokajy U 14 zazalahy sy zazavavy 2018 hotontosain’ny FMBB eny amin’ny kianja mitafon’Ankatso amin’ny sabotsy 23 sy alahady 24 jona 2018 izao ka rahampitso zoma 22 jona tolakandro no hanatanterahana ny fivoriana teknika etsy amin’ny foibe toeran’ny FMBB etsy 67 ha Atsimo.

 

Hifanindran-dalana amin’ity hetsika ity koa ny fifaninanana “AFROBASKET U18 MEN 5x5” fifanintsanana aty amin’ny “Zone 7” ka hifanandrinan’i Madagasikara sy Seychelles. Marihana fa eo ambany fanohanana mavitriky ny orinasa Telma Madagasikara daholo ireto fihaonana ireto ka hanolorany fanomezana isan-karazany toy ny mahazatra.

Ntsoavina Evariste

 

Tia Tanindranaza0 partages

Rallye Nankang Asacm 2018Mpifaninana 47 no hanainga eny Imerinkasinina rahampitso

Ny rallye Nankanga Asacm 2018 izay karakarain’ny klioba Asacm miaraka amin’ny tohan’ny Fmmsam hotontosaina ny 22, 23 ary 24 jona izao amin’ny lalana Ambohimanambola, Anjeva, Masindray,

Tia Tanindranaza0 partages

Sehatry ny fizahantanyMbola betsaka ireo olana tsy maintsy harenina

Mbola betsaka ireo olana eo amin’ny sehatry ny fizahantany tsy maintsy arenina eto Madagasikara. Anisan’ny tena nampitaraina ireo Malagasy monina any ivelany sy ireo vahiny tonga tetsy amin’ny Carlton Anosy,

 

omaly ny halafon’ny saran-dalana mankaty Madagasikara, ny tsy fandriampahalemana, ny hofan’ny trano fandraisam-bahiny, izay ataon’ireo tompon’andraikitra amin’ny vola Euros, raha tokony ho Ariary. Maika ny fanarenana, miampy ny fampitomboana isa ny fotodrafitrasa, hoy i Tiana Rasamimanana avy amin’ny vondrona SIPROMAD,  anisan’ny mpisehatra eo amin’ny fizahantany ihany koa. Ny fizahantany no anisan’ny sehatra hampidi-bola vahiny betsaka indrindra ho antsika eto Madagasikara. Maika ny fampirisihina ireo mpandraharaha handoa hetra. Nomarihiny manokana ihany koa fa tokony hohatsaraina ny lalana eto Madagasikara, raha tiana handroso ny sehatry ny fizahantany. Mila imasoana ihany koa ny fampidirana jiro, mba hahafahan’ireo teratany vahiny mandeha amin’ireo faritra misy biby sy zavaboary mampiavaka antsika eto Madagasikara, nefa tsy tongan’ny herinaratra.

 

Patty

Tia Tanindranaza0 partages

Depiote Mapar namadika tolonaHo sahirana amin’ny fifidianana manaraka eo

Samy niandrandra ny tolona ho an`ny fanovana ny rehetra tetsy amin`ny kianjan`ny 13 mey.

Tia Tanindranaza0 partages

Ramtane LamamraMpandamina sa mpanakorontana ?

Sesilany ny fanelanelanana nataon`ny sehatra iraisam-pirenena teto amintsika nandritra ny fihetsehem-bahoaka nanomboka ny 21 aprily.

 

 Nazava ny hevitr`ireo depiote ho an`ny fanovana tamin`izany fa tsy mahavaha olana ireo vahiny raha tsy mihaino ny fitakian`ny eny amin`ny kianjan`ny 13 mey. Tonga izao ny praiminisitra Ntsay Christian izay olona miara-miasa akaiky amin`ny sehatra iraisam-pirenena kanefa ny fomba nanendrena azy no mbola manjavonjavo. Taiza ho aiza no nisy ny fanelanelanana nataon`ny iraisam-pirenena ? Raha atao ny jery todika, maro ny dingana tsy nanaraka rindrandamina. Tsiahivina fa ny vondrona afrikanina no nialoha lalana ny rehetra nanao ny dingana fanelanelanana nandritra ny fotoana tena navaivay ireny. Tsy manaraka rafitra izany satria misy ny atao hoe “Syndrome de Troika”, izany hoe ny SADC notarihan`i Joaquim Chissano na koa ny Vondron`ny ranomasimbe indianina (COI) no tokony ho nampihavana voalohany. Rehefa tsy tena tafavoaka ny fanelanelana vao miditra an-tsehatra farany ny vondrona Afrikanina saingy nifanohitra amin`izay tanteraka ny zava-nitranga.  Tsy nahagaga matoa i Joachim Chissano nanaboribory resaka tamin`ny iraka nataon`ny volana mey lasa teo teto amintsika. Raha zohina, arofanina ho an`ny sehatra iraisam-pirenena i Ramtane Lamamra. Izy rahateo dia mpikambana ao amin`ny filankevitra ambony miandraikitra ny fanelanelanana iraisam-pirenena na Haut Comitè consultative de l`ONU. Izy rahateo dia minisitry ny raharaham-bahiny alzerianina teo aloha ary mahafantatra ireo mpitondra manerana ny kaotinanta afrikanina. Mazava fa izy no iraky ny sehatra iraisam-pirenena. Tena eo ambany vahohon’ny iraisam-pirenena i Madagasikara amin`izao fotoana. Maninona i Ramtane Lamamra, 65 taona, no tsy nanaraka ny dian`ireo namany rehetra izay niala teo amin`ny tontolon`ny politika ka nijanona any Alger fa izy no mbola mamita iraka ihany ? Raha mikorontana kosa ny fifidianana eto amintsika dia misy asa foana angamba. Maro no mihevitra fa tsy tena hoe hikaroka vahaolana no ataony eto fa maika fotsiny amin`ny fanatanterahana ny fifidianana ary hita taratra izany tamin`ny fanendrena an`i Ntsay Christian, praiminisitra lehiben`ny governemanta. Fifidianana no fantany. Raha fehezina, tsy hiraharaha fampihavanam-pirenena izany na fanovana rafitra eto amintsika i Ramtane Lamamra ary tsy hieritreritra handamina ireo laharampahamena mialoha ny fifidianana mihitsy ny tenany.

 Marigny A.

Tia Tanindranaza0 partages

Hajo Andrianainarivelo“Tsy ekena holalaovin’antoko politika 3 ny firenena”

Ny 8 jona lasa teo no nandrenesana farany an`i Hajo Andrianainarivelo, filoha nasionalin`ny antoko Malagasy Miara Miainga, nandritra ny fangataham-panazavana ny fifanarahana ara-politika teny amin`ny Fitsarana Avo momba ny Lalàmpanorenana (HCC) etsy Ambohidahy.

 

 Ankehitriny dia miantso ny HCC mba hamaly ny fitoriana napetraka ny tenany ary tsy hanao tsinontsinona an`izany. Nohamafisiny fa tsy  ara-dalàna ny fifanarahana ara-politika satria tsy ao anatin`ny fanapahan-kevitra navoakan`ny HCC. Tsy nisy ny fihaonana nataony na tamin`ny filoham-pirenena Hery Rajaonarimampianina na tamin’ny filohan`ny antoko HVM, Rivo Rakotovao, hoy i Hajo Andrianainarivelo. Miantso ny HCC ny antoko MMM hampihatra ny didy araka izay tokony ho izy satria tsy hiteraka fitoniana ny fifanarahana ambadika fa fanarahana ny lalàna no tokony hatao.  Mitsipka marin-drano ny fomba fanao eto Madagasikara ihany koa ny MMM satria toa lasa an`ny antokon`olona na vondron`olona i Madagasikara fa tsy an’ny Malagasy. Tsy ekena ny filalaovan`ny antoko politika telo ny fiainam-pirenena ary nohitsakitsahin`ireo antoko ireo ny didy tsy azo ivalozana navoakan`ny HCC ny 25 mey tamin`ny fisian`ny fifanarahana ara-politika nialoha ny hananganana ny governemanta. 

Marigny A.

Tia Tanindranaza0 partages

Fahaleovantena sy fitiavan-tanindrazanaTsy fiankinan-doha amin’ny vahiny no dikany ho an’ny sarambabe...

Homarihina amin’ny talata 26 jona ho avy izao ny tsingerin-taona faha-58 nahazoantsika ny fahaleovantena.

 

 Mbola manjavozavo anefa izany eto amintsika, indrindra fa raha mijery ny raharaham-pirenena misy ankehitriny. Tsy mbola hita taratra loatra hatreto fa tena mahaleotena isika eto Madagasikara. Misy hidiran’ireo mpanam-bola vahiny hatrany ireo zava-mitranga misy miaro fanerena an-kolaka. Mikasika ny fitiavan-tanindrazana indray dia samy milaza ho tia avokoa ny rehetra fa vitsy ireo vanona sy vonona ary tena mampihatra azy. Tahaka izao ny fanehoan-kevitry ny olona mikasika ny fahaleovantena sy fitiavan-tanindrazana eto amintsika.

Rtoa Malala : Ny fahaleovantena amiko tsy miankin-doha amin’ny vahiny intsony ary tsy misy idiran’ny vahiny izay zavatra hataontsika eto Madagasikara. Ny fitiavan-tanindrazana indray dia  tsy mivarotra tanindrazana satria isika teratany Malagasy no tokony hanjaka sy higoka ny tombontsoa azo avy aminy.

 

Rtoa Landy :Ny fitiavan-tanindrazana amiko mitsinjo ny hoavin’ny taranaka fa tsy manao gaborakaka. Ny fahaleovantena indray tsy fiankinan-doha amin’ny hafa intsony. Mikasika ny fananganan-tsaina manokana, indrindra amin’izao fetin’ny 26 jona izao dia tsy tokony hijerena resa-politika satria mariky ny fitiavan-tanindrazana ihany koa.

Pati

 

 

Tia Tanindranaza0 partages

Fandaminana anaty minisiteraHiteraka fitarazohan’ny asa fampandrosoana

Mahakely finoana ny toe-draharaha misy eto Madagasikara. Raha izao mantsy no mitohy dia mbola ho lavitry ny afo ny kitay. Tena mbola ho ela vao ho tratra ny tanjona ho fampandrosoana ity nosy ity.

 

Ny zava-misy amin’izao dia lany andro am-panaingana takotra tahaka ny boka mangala-pihinana ny any anaty minisitera any. Tsy maintsy mbola mandeha amin’ny fandaminana ela ary misy aza moa mbola variana manolosolo ny hatao  tananankavanana. Araka izany dia sarotra sy taraiky ny fanatanterahana ireo asa goavana mivaingana izay miandry. Izany anefa dia manome sary ratsy hatrany an’i Madagasikara ary raha mbola mitohy izao savorovoro misy izao dia tsy hiverina amin’ny laoniny mihitsy ny asa fandraharahana. Ireo mpiara-miombon’antoka sy ny mpamatsy vola efa malaina tanteraka noho ny zava-misy. Ireo sehatra iainan’ny toekarena tahaka ny fadintseranana sy ny hetra aza moa tsy milamina kanefa ireo no mamahana ny kitapom-bolam-panjakana. Mihitsoka tanteraka noho izany ny asa ary mainka mikatso ny fanatanterahana ny fifidianana. Raha mbola mitohy izao zava-misy izao dia hilentika ka ho sempotra sy kendaroroka ary  tsy hivoaka intsony  ny toekarena Malagasy. Mbola hiandry 10 taona indray vao afaka miandrandra fampandrosoana marina ary hizotra mankany amin’ny fahantrana mangitsokitsoka hatrany ity firenena ity.

Tsiry

 

 

Tia Tanindranaza0 partages

Ntsay ChristianEfa filohan’ny tetezamita ?

Diplomaty maromaro indray no noraisin’ny praiminisitra Ntsay Christian omaly, ka nivoitra tao anatin’izany ny fahavononan’ireo vahiny amin’ny fanohanana an’i Madagasikara, indrindra fa ny fanatontosana fifidianana.

 

 Voalohany tamin’izany i Harald Gehrig Ambasadaoron’i Allemagne, Naneho ny fahavononany sy ny faharesen-dahatra ny amin’ny hisian’ny fifidianana amin’ity taona ity, Mohamed Abdallah Cherif, avy amin’ny Banky afrikanina ho amin’ny Fampandrosoana (BAD) naneho ny fahavononana hatrany hiara-kiasa ; Philippe Brandt Ambasadaoron’i Suisse nitondra fiarahabana ny praiminisitra, ary naneho fahavononana amin’ny fanampiana amin’ny fifidianana filoha ; Rtoa Coralie Gevers, solontena maharitry ny Banky iraisam-pirenena ary Andriamatoa  Patrick Imam, solontena maharitry ny Tahirim-bola iraisam-pirenena (FMI) eto Madagasikara, izay nifanome toky tamin’ny praiminisitra amin’ny hanavaozana sy hanalefahana ny findramam-bolan’ny governemanta Malagasy.  Noraisin’ny praiminisitra ihany koa ny solontena avy amin’ny mpandraharaha avy amin’ny Vondron’ny orinasa eto Madagasikara (GEM) notarihin’ny filohany Rtoa Soanorondriaka Josephine Andriamamonjisoa. Andrasan’ireo mpandraharaha ny fampihodinana ny toekarena araka izay tokony ho izy ary ny handraisana fanapahan-kevitra amin’ny « dossier » sasantsasany izay efa niandry efa elaela. Toa takona tanteraka aloha i Hery Rajaonarimampianina amin’izao, ary tahaka ny tsy raharahian’ny vahiny intsony fa i Ntsay Christian no tsapa fa tena mitantana ny baolina ary efa tahaka ny filohan’ny tetezamita mihitsy aza, hoy ireo mpanara-baovao politika. Izy izay arovan’ilay didy navoakan’ny HCC ny 25 mey ary tsy azon’ny filoham-pirenena esorina amin’ny toerany sady mijanona eo mandra-pisiana filoham-pirenena vaovao voafidim-bahoaka.

Toky R

Tia Tanindranaza0 partages

Mpitondra malagasyMiharihary ny fitiavan-tseza tafahoatra

Ny fiambenana ireo minisitera hiadidian’ireo minisitra HVM miisa 14 izay takiana alana amin’ny toerany indray izany izao no vaindohan-draharahan’ny fitondram-panjakana Malagasy.

J. Mirija

Tia Tanindranaza0 partages

Kianjan’ny 13 meyTsy miato ny tolona na dia somparana aza…

Tonga maro ny vahoaka teny amin’ny Kianjan’ny 13 mey omaly, na nisy aza ny fisintahana tsy an-kiera nataon’ny MAPAR.

 

Toky R

 

 

 

Ino Vaovao0 partages

HETSIKA FARAN’NY HERINANDRO : Anjaranao sisa no misafidy izay metimety aminao

Vazo an-gitara Hampiara-peo etsy amin’ny Trass Tsiadana i Luk sy Rija Ramanantoanina sy Mahery

Hitondra ny vazo an-gitara etsy amin’ny Trass Tsiadana i Luk, Rija Rmanantoanina sy Mahery. Hanomboka amin’ny 9 ora alina sy seho hotanterahin’izy telo lahy ireto, ny zoma izao. Hampiara-peo no samy haneho ny talentany amin’ireo mpankafy izy telo lahy ireto amin’io fotoana io. Vazo an-gitara no hanjaka mandritra ny seho ka noho izany dia hira milamindamina no hiarahan’i Luk, Rija Ramanantoanina sy Mahery amin’ireo mpanara-dia azy eto an-drenivohitra.  

Mozika ho an’ny mozika

Olombelona Ricky sy ny namany hampiala voly ao amin’ny Piment Café Behoririka

Anio alina, hanatanteraka alim-pandihizana miavaka, etsy amin’ny Piment Café Behoririka ny Olombelona Ricky sy ny namany. Mozika ho an’ny mozika no lohahevitra hitondrany ny seho, ka hanakoako eny an-toerana avokoa ireo mozika nahafantarana ny mpanakanto hatramin’izay, toy ny “Ho avy any aho” sy “Hadinony ianao”. Manomboka amin’ny 9 ora ny alim-pandihizana ka mampanantena ny ambiansy ho an’ireo mpankafy azy ny Olombelona Ricky sy ireo namany.

Alim-pandihizana goavam-be

Hanafana ny sehatra malalaky ny AC Plaza Ivato i Wawa

Hiverina hanolotra ambiansy salegy mafana ho an’ny mponin’Antananarivo indray i Wawa sy ny saleginy, ny zoma alina izao. Etsy amin’ny AC Plaza Ivato no hanatontosany ny alim-pandihizana goavam-be sady miavaka ity. Hanakoako eny an-toerana avokoa ireo mozika na hira mampisongadina an’ny lehilahy eo amin’ny sehatry mozika mafana, toy ny “400 volt” sy “Salegy tsisy katramo”. Hitondra zava-baovao ho an’ireo tonga hanotrona ihany koa ny lehilahy amin’io fotoana. Manomboka amin’ny 9 ora ny alim-pandihizana, ka tsy voafetra ny fotoana fa ho mandra-paharain’ny andro.

Seho tropikaly

Hampitotorebika etsy amin’ny Le Glacier Analakely i Mamada

Hiverina hiaka-tsehatra i Mamada, ela tsy tazana ny lehilahy eo amin’ny fanatanterahana alim-pandihizana raha eto an-drenivohitra. Etsy amin’ny Le Glacier Analakely ny mpanakanto anio hanolotra ambiansy tropikaly ho an’ireo mpankafy izany. Hanomboka amin’ny 8 ora alina ny seho ary mozika tropikaly tanteraka no hanjaka ao an-toerana amin’io fotoana. Ny vazo milamindamina miresaka fitiavana tena nahafantarana ny mpanakanto eo amin’ny sehatry mozika ity fa manao gadona mozika mafana ihany koa ny lehilahy, tahaka ny tsapiky izay gadona mampiavaka ny Faritra Atsimo Andrefana iny. Hohirainy mandritra ny fiakarany sehatra ny “Ka meloke”.

Rnb

Smaven sy Jazz Lyon hampifety ao amin’ny Boite Noire Diego

Tanora roa mivoy ny gadona rnb no hanafana ny toeram-pilanonana Boite Noire ao Antsiranana, ny sabotsy alina izao. Tovolahy avy any amin’ny Faritra Sava i Smaven gadona rnb tena ahafantarana azy io eo amin’ny sehatry ny mozika. Misongadina tokoa izy io tato ho ato fa indrindra eto an-drenivohitra satria maro ny hirany no tsy afaka am-bavany maro toy ny “Mafana” sy “Afa-po”. Tsy latsa-danja ihany koa ny mozikan’i Jazz Lyon. Hitondra ny talentany ity tanora ity mandritra ny alim-pandihizana tontosainy rahampitso. Mpanakanto avy any amin’ny tapany Avaratry ny Nosy iny avokoa izy mirahalahy ireto. Hanomboka amin’ny 9 ora ny fety ka tsy voafetra ny fotoana fa ho mandra-paharain’ny andro.

Mozika mafana

Hampifety ao amin’ny Shakira Night Club i Dalvi’s

Hitondra ny “To tsy volan’i Babanao” ao amin’ny renivohitr’ i Boeny i Dalvi’s, ny sabotsy izao. Misongadina tokoa ity tanora ity tato ho ato fa indrindra ny namoahany ny rakikira mitondra ny lohateny hoe “To tsy volan’i babanao” izay tsy afaka am-bavan’ny mpankafy mihitsy. Manao fitetezam-paritra ihany koa ny tovolahy efa ho iray volana izay. Mampanantena ambiansy mafana ho an’ireo mpankafy azy ao Mahajanga ny mpanakanto. Hanomboka amin’ny 10 ora ny alim-pandihizana goavana ity ka tsy voafetra ny fotoana fa ho mandra-paharain’ny andro.

Pounie

Ino Vaovao0 partages

FANATANJAHANTENA : Miroborobo tanteraka ny sekolin’ny basketball ao Toamasina

 Ity farany izay mahomby ary azo lazaina ho mihazona laharana voalohany raha ho an’ i Toamasina , faharoa ny haiady kick-boxing ary eo amin’ny laharana fahatelo ny hazakazaka, raha fahefatra ny volleyball izay ahitana ny Stef’Auto. Eo amin’ny laharana fahadimy ny tsipy kanetibe ary any amin’ny laharana fahaenina ny taranja lomano. 

Any amin’ny laharana fahafito kosa ny baolina kitra izay sarotra ny fahitana an’i Toamasina misolo tena an’ i Madagasikara any ivelany tato anatin’ny folo taona.Vokany mba tsy handatsaka lanja an’ izay taranja isan-karazany izay dia nametraka paik’ ady ireo andriambavilanitra izay efa nitondra ny lazan’i Madagasikara teo amin’ny taranja basketball, ka lasa fifaninanana masina ny fananganana sekoly ho an’ankizy amin’ny taranja basketball. 

Ho an-dRakotozafy Sabine, mpilalao kalaza tao amin’ny klioba As port fahiny sy tao amin’ ny Ascut, dia efa an-jatony ireo ankizy mpianatra manaraka fanazaran-tena isaky ny alarobia sy sabotsy tolakandro ao amin’ny kianja malalaky ny DRJS. Tahaka ny fianarana rehetra, dia misy saram-pianarana ho an’ireo ankizy mpianatra. Mamolavola ankizy tia fanatanjahantena sy manana tanjona ambony i Rakotozafy Sabine.

Kamy

Ino Vaovao0 partages

VONONA NY FIKARAKARANA NY FESTIVAL DES BALEINES : Nivoaka ny anaran’ ireo mpanakanto

Andiany fahatelo io hatao ny volana jolay 2018 io. Ny fikambanana Drôles de Dames Sainte-Marie no tompo-marika amin’ny fikarakarana. Efa ao anatin’ny fanomanana tanteraka ny ao Sainte-Marie. 

Fantatra amin’izao fotoana izao ireo mpanakanto kalaza hanafana ny festival. Anisan’izany i Tence Mena, Mad Max, Dalvis ary Fafass. Hisyihany koa ireo mpanakanto avy any ivelany, dia ny Maloya de la Réunion, Simangavole de la Réunion. 

Toy ny efa fanao isan-taona, dia misy ny fifaninanana baolina kitra lalaovina ambony fasi-dranomasina na beach soccer, fifaninanana mivoy lakana, fifaninanana dia an-tongotra, hazakazaka am-bisikilieta, fifaninanana nahandro, zumba. Efa vonona tanteraka ny fikarakarana izao festival andiany faha-3 izao.

Kamy

Ino Vaovao0 partages

FETIM-PIRENENA AO TOAMASINA : Ho avy hanafana ny lanonana i Théo Rakotovao sy Bartez

Ny takarivan’ny alarobia 20 jona lasa teo, dia nisy ny tafa ho an’ny mpanao gazety nataon’ny préfet Toamasina, Cyrille Benandrasana. Nambarany nandritra izany fa nasiana fanatsarana ireo hetsika tanterahina ao Toamasina mandritra izao fanamarihana ny faha-58 taonan’ny fahaleovantena Malagasy izao. Ankoatra ireo artista ao an-toerana, dia fantatra izao fa anisany ho avy hanafana ny lanonana i Théo Rakotovao sy Bartez. 

Ankoatra azy roalahy, dia mpanakanto malaza ho tonga ao Toamasina hampifalifaly ny vahoaka eny amorondranomasina koa i Marcello sy Boy Black ary Nantenaina. Ao anatin’ny listra ihany koa ny artista zana-tany Boss Mananariens sy Rigo Tsy Mipoera. Nomarihin’ny prefet Toamasina nandritra ny fihaonana tamin’ny mpanao gazety ny harivan’ny alarobia io fa tanterahina ny alatsinainy 25 jona amin’ny 9 ora maraina ny fampisalorana ireo mari-boninahi- pirenena ho an’olona nahavita be teto amin’ny firenena. Fantatra fa manodidina ny 160 ireo nahazo izany raha ho an’i Toamasina manokana.

Kamy

La Vérité0 partages

Grève des enseignants - Une feuille de route de sortie de crise attendue

Une issue en gestation ? Les diverses négociations entre le ministre de l’Education nationale (MEN), Gatien Horace, et les représentants des syndicats des enseignants ont récemment abouti à la mise en place d’une cellule technique de crise. Celle-ci a élaboré une fiche technique, proposée cette semaine au ministre des Finances et du Budget en vue de déterminer une issue. La fiche technique propose les actions pouvant être menées à court, à moyen et à long terme afin de satisfaire les requêtes des enseignants.

« Une feuille de route de sortie de crise est attendue demain à midi (ndlr ce jour) dans le but de suspendre la manifestation des enseignants. La totalité de leurs revendications ne peut être satisfaite, dans la mesure où ils demandent des indemnités s’élevant à 400 000 ariary en tout. L’Etat n’en a pas les moyens. Par contre, une partie de ces requêtes pourra être assouvie et pourra être proposée aux parlementaires en vue d’une étude pour son intégration dans la loi des Finances rectificative », explique le ministre de tutelle.Paiement en vue des arriérés de vacationLes professeurs certifiés d’Education physique et sportive (EPS) pourront prochainement reprendre cette épreuve pratique. Celle-ci a été suspendue pendant quelques semaines puisque les profs réclament leurs vacations, impayées depuis 2014. « Le paiement des arriérés de vacation de 2014, 2015, 2016 et 2017 se fera très prochainement. La somme pour ce faire est déjà disponible », rassure le numéro un du MEN. Ce responsable d’ajouter que l’épreuve d’EPS pourra se faire incessamment, malgré la menace d’annulation avancée par les profs.Concernant les examens officiels du CEPE et du BEPC, les dates sont maintenues respectivement pour le 31 juillet et du 20 au 23 août. Les élèves en classe d’examen continuent à suivre les cours malgré la grève des enseignants, à en croire le ministre de tutelle. Par contre, ce dernier semble sceptique quant aux résultats scolaires de cette année pour les établissements publics. Ceci d’autant plus que les cours n’ont jamais cessé dans les établissements privés, malgré le contexte politique actuel. « Les élèves devront rester la priorité des enseignants. Ils sont ainsi sollicités à reprendre les cours le plus tôt possible », conclut le ministre. Affaire à suivre !Patricia Ramavonirina

La Vérité0 partages

Assassinat d’un maire à Toliara II - Un accrochage entre les gendarmes et les tueurs fait 1 mort

Le 16 juin dernier, Nathaly Hedaraly, maire de la Commune de Tsianisiha se trouvant à Toliara II est décédé à la suite d’un assassinat. L’enquête menée par la Gendarmerie a permis d’identifier le principal suspect, un certain Rebona domicilié à Beravy Antsoity. L’affaire ne s’était donc pas arrêtée là. Le soir du 19 juin, elle a connu un rebondissement, qui s’est traduit par une véritable escalade lorsque les Forces de l’ordre ont accroché Rebona et ses acolytes. L’affaire a débouché sur un épisode encore meurtrier où un assaillant fut abattu lorsqu’un accrochage a opposé  une équipe  de gendarmes et l’auto-défense ou « Dinabe » local  d’une part,  et les éléments  dudit Rebona, l’auteur supposé du meurtre.  Ces escarmouches s’étaient produites tout au long des  ratissages dans les zones comprises entre Tsiafanoka, Antanimena,  Antsoity et la forêt de 

Tsiafanoka, lieu de refuge  de Rekonta, le devin actuellement au service de Rebona.  Cette affaire a mobilisé personnellement le commandant de compagnie de gendarmerie local  et ses éléments pour renforcer les gendarmes déjà en place. 

 

Pour un bref rappel des faits,  le maire de la dite Commune a été tué avec une arme à feu.  Sitôt après son sale coup, le présumé tueur a pris fuite dans la forêt sise à l’Est de la Commune.  Depuis lors, des gendarmes de la Brigade d’Ankililoaka, de Milenaka, et de Tsianisiha dirigés par  le commandant de compagnie de Toliara se sont rendus sur les lieux. Les investigations qu’ils ont menées ont alors abouti sur la piste du présumé assassin Rebona, qui était avec ses éléments lorsque les gendarmes les ont accrochés le soir du 19 juin.

Dernièrement, l’on a assisté à une série de massacres visant des maires de différentes Communes du pays si l’on ne citait que le cas de l'adjoint au maire d’Antanetibe Anjorobe en février 2018. L’année dernière, notamment le mois de juillet,  a été particulièrement sanglante avec une succession d’assassinats ayant touché tour à tour  le maire de la Commune d’Ambalankindresy en juillet 2017, celui d’Ampefy le 8 juillet 2017, ou encore celui de Maevatanàna en juin 2017. Bref, une série noire qui amène à s’interroger sur les véritables motivations de ces agressions meurtrières. 

  Franck Roland

La Vérité0 partages

Problème d'éthique !

En 15 +2 jours de la nomination du Premier ministre de consensus (PMC), la situation politique malagasy n'a rien évolué. Nommé le 4 juin 2018, Ntsay Christian n'est pas encore sorti de l'auberge. En dix jours d'existence, le Gouvernement tente, tant bien que mal, de démarrer.Sur la Place du 13 mai, la tension ne baisse pas.

« Le mouvement pour le changement » sous la houlette d'une partie des 73 députés continue de maintenir la pression. Certains syndicats surtout ceux de la Communication et des Relations avec les Institutions, des Postes et télécommunication, des Finances et du Budget ou de l'Education nationale ne décolèrent point. Ils persistent et signent sur le refus catégorique aux nominations de ces ministres « indignes » à la tête de leur département respectif.Alors, les agents de l'Etat frustrés montent sans relâche au créneau sinon sur le toit et crient toujours au scandale.Le silence radio d'Iavoloha complique la situation ? Une sourde oreille des plus inquiétantes ! Les observateurs de la vie nationale de se demander jusqu'à quand va-t-il durer ce bras de fer ? De toutes les manières, malgré ces fausses notes gênantes, parfois ennuyeuses, et en raison de l'urgence de la mission à accomplir, le PMC agit de son mieux et de toutes ses possibilités pour faire tourner la machine administrative.Les analystes pointilleux s'accordent à conclure que le manque chronique d'éthique se trouve à la base de cette cacophonie générale qui prévaut dans le pays.Larousse définit l'éthique en ces termes, entre autres, « qui concerne les principes de la morale » ou encore « un ensemble de règles de conduite ». En d'autres termes, un ensemble de principes ou de règles devant dicter les comportements d'un homme, digne de l'être, en le conduisant ipso facto vers le respect des normes, tout au moins, des valeurs normatives par extension  des lois en vigueur dans son pays. Par conséquent, l'absence d'éthique, notamment chez les dirigeants, impacte cruellement sur le fonctionnement harmonieux de la vie du pays.Il n'est donc pas nécessaire de recourir à l'expertise d'un sociologue politique ou d'un psychologue social et de la morale politique chevronné pour mettre en évidence que le manque d'éthique dans la direction des affaires de l'Etat contribue à la dégénérescence du fondement du développement. Tout problème lié au manque d'éthique amène tout naturellement vers le mépris de la loi, en premier lieu, la Constitution. Le régime HVM, en quatre ans et demi de règne, dénué de tout principe de la morale politique, piétinait la tête de la Loi fondamentale. Le Chef de l'Etat, le premier à le méprendre, préside les destinées de la Nation comme si elle (la Constitution) n'existait pas. Dans le même ordre d'idée, les verdicts prononcés par les juridictions, en particulier ceux qui condamnaient les dirigeants en place, sont ignorés royalement.De fil en aiguille, la gestion des deniers publics ne respectent, non plus et en aucun cas, la déontologie en ce sens que l'orthodoxie financière se voit être le dernier des soucis des maîtres de la finance publique. Et le manquement aux paroles données et l'infection généralisée de la corruption n'en sont que des effets corollaires.En somme, le cafouillage que le pays traverse en ce moment vient du problème d'éthique.Ndrianaivo

La Vérité0 partages

Calendrier électoral - Le Premier ministre entretient le flou

Elections anticipées ou pas ? Le Premier ministre Christian Ntsay était évasif hier face aux journalistes lors d'une conférence de presse organisée au Palais de Mahazoarivo. Le chef du Gouvernement s'est entretenu avec la presse à l'issue d'une réunion conjointe entre le Premier ministre, le président de la CENI, le ministre de l'Intérieur et le ministre des Finances hier à Mahazoarivo. D'emblée, il a rappelé que le principal objectif de la mise en place du Gouvernement est l'organisation d'une élection présidentielle inclusive, transparente et acceptée par tous conformément  aux dispositions de la Constitution confortées par la décision de la Haute Cour constitutionnelle. Les élections qui sont perçues comme seule et unique issue à la crise que traverse le pays.

« Nous avançons vers les préparatifs électoraux et allons aboutir à la détermination du calendrier électoral », a réitéré le locataire de Mahazoarivo. D'ailleurs, l'objectif de la réunion d'hier était de « mieux cerner l'ensemble des questions touchant les élections, pas seulement la date, mais aussi l'état budgétaire entre autres », selon les précisions. Malgré l'insistance des journalistes, le patron de la Primature entretient le flou sur la tenue des élections cette année. Il continue néanmoins de se référer à la décision de la HCC le 25 mai dernier. Décision qui mentionne la tenue d'une élection présidentielle anticipée.Date des élections, mais pas seulement…A entendre le Premier ministre, il y a eu déjà un  échange entre le Gouvernement et les membres de la Commission électorale nationale indépendante. Il soutient que la date des élections n'est pas le seul point important, mais également les lois électorales, la sécurité ainsi que le budget électoral. A cet effet, Christian Ntsay soutient que « le Gouvernement travaille d'arrache - pied pour que le Parlement puisse approuver la loi des Finances rectificative ».Rappelons que la classe politique est actuellement divisée. Quant à l'issue de la crise ,le président du MAPAR, Andry Rajoelina a insisté sur la nécessité de publier le calendrier électoral pour permettre la tenue d'élections inclusives, libres et transparentes. L'ex - président de la Transition et ses partisans roulent pour la tenue d'une élection présidentielle anticipée. D'autre part, le TIM de Marc Ravalomanana met l'accent sur le besoin de réorganiser la CENI dont la composition actuelle ne semble pas satisfaire cette formation politique. En tout cas, la publication du calendrier électoral permettra à tous les acteurs d'être fixés sur leur sort.Sandra R.

La Vérité0 partages

Salon de l'industrie de Madagascar - Quatre jours de promotion et de discussion

La 4e édition du Salon de l'industrie de Madagascar a ouvert ses portes hier, à la zone Forello Tanjombato. Durant quatre jours, plus de 200 industries malagasy, entre autres la Star ou encore le Groupe SIPROMAD, issues des quatre coins de l'île vont y exposer leurs produits. Cet évènement est une occasion pour les industriels de faire la promotion de leurs produits auprès des consommateurs malagasy, mais aussi de discuter des lacunes qui empêchent encore le secteur secondaire de se développer à Madagascar. Cette édition marque également le 60e anniversaire du Syndicat des industries de Madagascar.

Secteur industriel : un développement freiné par des obstacles« Malagasy ny antsika ». Le secteur industriel est très important dans le développement d'une économie. Malheureusement, dans la Grande île, beaucoup d'obstacles freinent encore actuellement son développement. Et Freddy Rajaonera, président du Syndicat des industries de Madagascar (SIM), en même a touché un mot aux ministères concernés, hier, lors de l'ouverture de la 4e édition du Salon de l'industrie de Madagascar. « Actuellement, l'industrie affronte une nouvelle période d'incertitude avec l'avancée de la technologie, une libéralisation sauvage mais aussi avec une mondialisation de plus en plus précise », a-t-il expliqué dans son allocution. Le contexte de l'insécurité aiguë sous tous ses angles a également été mentionné. Et lui d'ajouter : « L'importation sauvage et la concurrence déloyale favorisent encore jusqu'à l'heure actuelle l'insécurité économique pour tous les industriels et les entrepreneurs malagasy ». Les industriels ne sont effectivement pas contre une libéralisation de l'économie malagasy. Ils demandent simplement à ce que l'Etat leur offre une visibilité ou mieux encore une protection pour que la population consomme davantage des produits « Vita malagasy » et contribue ainsi au développement du secteur secondaire, mais aussi de tout le système économique. Dans tous les cas, le SIM soutient que le développement économique du pays a besoin de certitude et de stabilité pour pouvoir s'opérer pleinement.Dossier réalisé par Rova R. et Zouzie

La Vérité0 partages

Permis biométrique - Mahafaly Olivier doit répondre de l’arnaque du siècle

N’en déplaise à l’actuel Chef du Gouvernement qui s’interdit et interdit les chasses aux sorcières, il y a tout de même certains faits imputables à des personnalités Hvm  récemment déchus du pouvoir qui méritent de ne pas rester impunis. Il en est ainsi de l’opération « permis biométrique » que l’ancien ministre de l’Intérieur et non moins ex-Premier ministre, Olivier Mahafaly Solonandrasana, a lancée en octobre 2015. 

A l’heure actuelle, il apparaît que l’opération s’est révélée être une gigantesque arnaque au détriment des dizaines de milliers d’administrés qui ont déjà procédé au changement de leur ancien permis. En effet, non seulement ces derniers ont été obligés de se plier aux dures contraintes des dates butoirs insensées qui leur ont été imposées, mais il se trouve également que les 38 000 ariary qu’ils ont dû débourser pour avoir leur sésame n’auront servi à rien, l’opération, s’étant terminée finalement en queue de poisson.

 

Il faut savoir en effet que, selon  la note N° 2947 – MID/DG, publiée par Olivier Mahafaly Solonandrasana le 19 décembre 2017 (en sa qualité de ministre de l’Intérieur de l’époque), le dernier délai accordé à ceux qui n’auront pas encore renouvelé leur  permis de conduire a  été fixée au 30 juin 2018, une échéance qui expire dans  9 jours exactement (dont 

5 ouvrables) . Selon l’initiateur de l’opération lui-même dans la note suscitée, « passé ce délai, l’ancien permis de conduire ne sera plus valable sur toute l’étendue du territoire ». Or, sauf erreur de notre part et à moins de délivrance en catimini, depuis la date de sortie de cette note, la délivrance des nouveaux permis n’a pas repris et ce, depuis qu’elle a été suspendue pour soi-disant rupture de stock des cartes destinées aux nouveaux documents. 

Mais il est à rappeler également que l’opération en elle-même est au centre de vives polémiques et a été même qualifiée par beaucoup d’ « escroquerie » pure et simple. Il se trouve en effet que les principales innovations censées être apportées par les nouveaux permis, à savoir la facilitation des contrôles pour débusquer les falsifications et la disposition de bases de données consultables au plan national et international, se sont révélées être des coquilles vides. Non seulement les policiers de la route locaux ne disposent pas des appareils leur permettant d’effectuer un quelconque contrôle mais le Qr code présent sur le document ne fournit pas non plus la moindre information exploitable lorsqu’il est scanné  ici ou ailleurs.

 

Un vulgaire carton plastifié

D’après les dernières estimations fournies par les responsables du ministère de l’Intérieur en décembre 2017, près de 65% des permis existants à Madagascar ont déjà été renouvelés à cette date. Malgré notre insistance auprès du Centre immatriculateur d’Ambohidahy récemment, le responsable sur place s’est refusé de communiquer le nombre total de documents concernés.  Un chiffre qui aurait pourtant été intéressant à savoir car il aurait permis de connaître le montant brut des droits déjà encaissés dans le cadre de cette opération. On se demande par ailleurs sur les raisons qui ont dicté l’imposition de dates butoirs relativement serrées, lesquelles avaient contraint les citoyens à faire la queue des heures durant et de jour comme de nuit, à Ambohidahy, si ce n’est la hâte de renflouer la caisse (laquelle?). Car avec le recul, on s’aperçoit qu’il n’y avait donc nullement urgence.

Pour l’instant, tel qu’il se présente actuellement, le  « permis biométrique » malagasy n’est qu’un PVC imprimé ou un vulgaire carton plastifié alors que des milliards d’ariary sont en jeu. Dans tous les cas, un audit s’impose sur ce sujet précis, afin de déterminer quelle est la part du prestataire slovène dans l’histoire et où est passé le surplus éventuel. L’actuel ministre de l’Intérieur a tout intérêt à diligenter un tel audit, ne serait-ce que pour ne pas endosser la responsabilité des éventuelles malversations qui pourraient être éventées ultérieurement. Il en est de même d’ailleurs des autres documents dits « biométriques » (Cartes grises et passeports), relevant du seul et même ministère de l’Intérieur.

La Rédaction

Midi Madagasikara0 partages

« Vazo miteny » : Ifanihy en solo au « Twenty six »

Le crooner offre une prélude de la fête de l’indépendance.

Le messie de la chanson à texte, la langue baladeuse, met les bouchées doubles ces derniers temps.

Ses chansons sont de véritables petits scenarii  et racontent des tranches de vie qui peuvent nous interpeller. Héros de l’édition  2014 du festival de bande dessinée «  Gasy bulles », tout semble sourire à Ifanihy. Pour ses inconditionnels, ses multiples apparitions fait bien des heureux. Vendredi, ce ténor du « vazo miteny » donne rendez-vous aux noctambules au « Twenty six » Analakely.  Fervent compositeur de chanson à texte, Ifanihy est resté fidèle à son image depuis tant d’années. Toujours armé de sa guitare et de micro, à lui tout seul, il réussit toujours à séduire bien de  gens.

Si« Lesabotsy » et « Ikala Dauphine » ont fait ses succès, le chanteur reprendra toutes ces chansons avec lesquelles le public l’a connu, mais il saisira surtout cette opportunité pour présenter « Mitsongoloka », un de ses albums. Les titres comme « Izakakely », « Eny rahavako », « Indreto », ou encore « Ty vava » figureront dans son répertoire. Une occasion pour tous les inconditionnels de découvrir ses dernières compositions.

Adoptant cette formule qui gagne, il aime dialoguer avec les spectateurs. Intimiste, Ifanihy a toujours privilégié les scènes restreintes. Une fois de plus, il sera seul avec sa guitare pour interpréter ses chansons dont les paroles s’écoutent et s’apprécient sans modération. Comme l’occasion se présente, elle est donc à saisir et à ne rater sous aucun prétexte.

Zo Toniaina

Midi Madagasikara0 partages

Fête de l’Indépendance : « Tsenan’ny kiloonga » pour les tout petits

« La fête continue à Akoor». Dans le cadre de la Fête nationale et du mois de l’Enfance, le salon « Tsenan’ny kiloonga » sera dédié aux enfants, du 22 au 24 juin. Divers jeux gratuits attendront les enfants de tout âge. « Baby foot », jeux de construction, maison cartonnée à colorier, sable magique, billard, dînette, jeu de points géant ainsi que des vêtements pour enfants et pour bébés seront à la disposition des tout petits.

Pour une virée en famille pendant les fêtes, Akoor digue fait partie des endroits phares à Antananarivo.  Ce salon tombe à pic pour ceux qui souhaitent joindre l’utile à l’agréable autour d’un bon petit plat. Pour cette toute première édition, il y aura une quinzaine d’exposants proposant des jouets, « high-tech », habillement, outils et accessoires. Aussi, tous les enfants qui passeront à Akoor durant les fêtes se verront offrir de petits lampions avec des friandises. Les grands ne seront pas non plus en reste.  Akoor leur prépare maintes surprises.

Zo Toniaina

Midi Madagasikara0 partages

« Grappling Tournament » : Rendez-vous ce week-end au Dojo Esca

Les combattants du club Attila prêts pour le tournoi.

2008-2018. A l’occasion de la célébration de son  10e anniversaire, le club de Jiu-jitsu brésilien Attila organise la 14e édition du « Grappling Tournament ». Un tournoi grandiose qui se disputera les 23 et 24 juin 2018 au Dojo ESCA Antanimena. Un rendez-vous à ne pas rater pour tous les passionnés et pratiquants de cette discipline. Plusieurs clubs de jiu-jitsu dont SFS, Estrella, base, CICERO, ou encore Checkmat ont déjà confirmé leur participation, sans oublier les clubs de lutte comme Rossary. Le samedi 23 juin 2018 sera consacré au tournoi de jiu-jitsu brésilien avec kimono et le dimanche 24 juin ce sera des combats « spécial Grappling » ou entre autres du jiu-jitsu brésilien sans kimono. La compétition est ouverte à toutes les catégories de poids allant du poids plume jusqu’au poids super lourd. Le tournoi a été subdivisé en trois catégories d’âge, celles des moins de 16 ans, de plus de 16 ans et  masters pour les + de 30 ans. En mémoire d’un membre fondateur du club décédé en début du mois, les combattants disputeront le trophée Beniaina. Le club est présent à Toamasina à travers l’Académie de Jiu-jitsu brésilien Attila 501 menée par Sensei Willy Maroha. Ce tournoi n’est qu’un avant-goût de la célébration, car d’autres activités seront prévues pour la promotion de cette discipline à Madagascar .

T.H

Midi Madagasikara0 partages

Ambohimahasoa : Novetavetainy ny zanany 6 taona avy eo nofirainy famaky ho faty

Efa ray tsy mifaditrovana mihitsy !  Lehilahy iray fantatra amin’ny anarana hoe « Jean Jacques » no lavon’ny balan’ny pôlisy rehefa tsy nety natao sambo-belona, tany amin’iny distrika Ambohimahasoa iny. Izany dia taorian’ny fanenjehan’ny pôlisy azy, raha avy namono nahafaty ny zanany vavikely vao enin-taona monja, rehefa avy nampiharany ny filan-dratsiny.

Araka ny tatitra azo avy amin’ny pôlisim-pirenena dia fantatra fa jiolahy rain-dahiny, ary isan’ny nampikaikaika ireo mponina tany amin’iny distrika iny ity lehilahy ity. Na io amina resaka asan-dahalo na resaka fanafihana mitam-piadiana. Efa maherin’ny 50 isa any ho any ireo olona novonoiny, araka ny fanazavàna azo hatrany. Omby efa an-jatony mahery ihany koa no efa azon’Ingahy Jean Jacques  sy ny ekipany. Ny habibiana farany nataony dia ity tamin’ny zanany ity sy ny rafozany. Rehefa nanamparany ny filàny mantsy ilay ankizivavy kely vao enin-taona monja dia nofirainy tamin’ny famaky ny lohany, ho faty. Taorian’io dia novelesiny tamin’ny akalo ihany koa ny rafozany ho faty. Nitsoaka ranamana taorian’izay habibiana nataony izany saingy ny alin’io dia nifanenjehan’ny pôlisy teny Ambohitsaramadina, Ambohimahasoa. Tsy nety nilavo lefona mihitsy izy tamin’io fotoana io ary mbola namaly ireo nanenjika azy aza. Hany ka voatery nitifitra ireo pôlisy ary lavo nandritra izany ity jiolahy rain-dahiny ity. « Tantara ratsy iray ho an’ny mponin’Ambohimahasoa ity nivalona ity ka feno hipoka ny kianjan’ny kaominina nitangorona sy nijery raha vantany vao nahare fa lavon’ny polisin’Ambohimahasoa ity dahalo izay fototry ny fahorian’izy ireo ity. Miezaka hatrany ny Polisim-pirenena mampandry fahalemana ny faritra rehetra izay nametrahana azy ireo ary mijoro ho aron’ny vahoaka sy ny fananany sy ho andrin’ny filaminana», hoy ny fampitam-baovao.

m.L

Midi Madagasikara0 partages

Ambato Boeny : Tovolahy mpanara-dia, maty tsy tra-drano notifirin’ny dahalo

Manoloana ny firongatry ny asan-dahalo any amin’ny distrikan’ Ambato Boeny, dia miraviravy tanana, very fanahy mbola velona ireo tantsaha eny ambanivohitra, satria ankoatra ny fananana very lasan’ny dahalo, mandatsaka aina ihany koa ireo mpanani-bohitra. Taorian’ny fanafihan-dahalo niseho tao Tsaramandroso, nahaverezana omby 12 isa izay lasan’ny malaso nirongo basy (nisy tamin’ny dahalo nampiasa Kalachnikov), afak’omaly, dia nanao ny fanarahan-dia ny fokonolona teo an-tanàna. Tao anaty fifampitifirana, dia tovolahy iray tamin’ireo mpanara-dia no maty tsy tra-drano lavon’ny balan’ ireo mpangalatra omby, ary olona dimy hafa naratra mafy voatifitra, hoy ny vaovao.

Eric Manitrisa

Midi Madagasikara0 partages

Coupe du Monde 2018 : Le Sénégal et l’Afrique retrouvent le sourire !

Enfin ! C’est le ouf de soulagement de chaque Africain qui se respecte après que le Sénégal a battu la Pologne de Lewandoski pour prendre la deuxième place de son groupe. Une première victoire qui fait le bonheur de l’Afrique toute entière. Une juste consécration d’un match complet même si on n’avait pas assez vu la star sénégalaise Sadio Mané.

Mais même sans Mané, les Lions de la Teranga possèdent des hommes capables de faire la différence comme ce M’Baye Niang qu’il va falloir surveiller à Mahamasina en septembre, tant cet attaquant de Torino sait comment s’y prendre pour partir en contre comme ce fut le cas quand Krychowiak rata sa remise sur le gardien (60e ) et marqua le but de la victoire.

Mais dans un schéma pareil, le fautif parvenait toujours à se rattraper, puisque le même Krychowiak permit à la Pologne de réduire le score. Mais c’était trop tard (86e ) pour espérer bousculer les Lions sénégalais qui avaient été quelque peu chanceux quand Clonek marqua contre son camp (37e ).

On notera en passant la belle prestation du portier sénégalais Khadim N’Diaye, mais cette solide défense obéissant au géant de Naples du nom de Coulibaly et qui a fait voir de toutes les couleurs à l’attaquant bavarois Lewandowski.

Une solidité défensive qu’il va falloir confirmer le 24 juin contre le surprenant Japon en vue de la lutte pour la première place du groupe. Mais une rencontre à la portée de Sadio Mané et de ses camarades. Il suffit d’y croire et d’empêcher les Japonais de développer leur jeu tout en mouvement. Allez l’Afrique !

Clément RABARY

Midi Madagasikara0 partages

Ambohimangakely By pass : « Casseur de vitesse » vao namboarina, nahatonga loza sahady

Hisoroka ny loza no natao kanjo vao mainka nampitera-doza ilay raha ! Vao tsy nisy andro vitsivitsy akory ny nahavitan’ireo mpanakana hafainganam-pandeha na « casseur de vitesse », napetraka teny amin’iny lalan’i Bypass, Ambohimangakely iny, dia efa nitera-doza sahady. Fiara kely iray no nitsimbadibadika ary nivarina tany an-tanimbary vokatr’izay, ny alin’ny talata lasa teo. Soa ihany araka ny angom-baovao azo fa fahasimbana ara-materialy fotsiny no nitranga fa mba tsy nisy aina nafoy tao anatin’izany lozam-pifamoivoizana izany. Ny sabotsy teo tokoa no napetraka ireo dongona ireto, tokony ho am-polony metatra miala ilay tobin-dasantsy vaovao eny an-toerana raha hitodi-doha hiatsinanana. Tranga izay isan’ny nahagaga ireo mpampiasa lalana maro ihany ny antom-pisiany. Hany ka raha mpamily zatra lalan-dririnina na izay vao nindrana iny lalana iny ka mandeha amin’ny alina dia tsy maintsy ho tra-doza foana na ho simba fananana. Ambonin’ny hoe, vao haingana tokoa mantsy no napetraka ilay izy dia tsy ahitana fampahafantarana ihany koa  ireo dongona natao hanenana hafainganam-pandeha ireo raha tsy efa akaiky kely. Mangataka izay tompon’andraikitra araka izany ireo mpampiasa lalana mba hijery akaiky sy haingana ity zavatra ity. Sao sanatria, hoy izy ireo, hiandry faty olona hikararana indray vao handray fepetra.

m.L

Midi Madagasikara0 partages

Les Marocains meurent les armes à la main

Dominant la rencontre de la tête et des épaules, le Maroc n’a pu rien faire devant le Portugal décidé à défendre le but marqué très tôt par Cristiano Ronaldo d’une superbe tête (4e ).

Pepe et ses camarades n’ont fait que détruire tous les assauts des Marocains à qui il manquait cependant un peu de réussite pour trouver le chemin des filets portugais. Un  minimum de jugeote aussi pour l’arbitre du match qui a refusé d’accorder le penalty sur une main évidente de Pepe.

Le danger aurait pu venir de Mehdi Benatia, l’ancien du Bayern de Munich qui fait aujourd’hui le bonheur de la Juventus, mais par deux fois la star marocaine enleva son puissant tir.

Et c’est bien dommage, car sur l’ensemble du match, les Lions de l’Atlas méritaient de gagner. Mais on ne peut pas leur en tenir rigueur, car pour tout dire, ils sont morts les armes à la main.

Clément RABARY

Midi Madagasikara0 partages

Epreuves d’EPS : Reportées aussi pour les candidats au baccalauréat

Au BEPC comme au bac, les épreuves d’EPS se tiennent toujours pendant plusieurs semaines, voire quelques mois, avant les épreuves écrites. Photo d’archives.

Après la suspension des épreuves d’EPS pour les candidats au BEPC, les candidats au baccalauréat sont, à leur tour, touchés par les impacts de la grève des enseignants de l’Education nationale.

 Pas d’épreuves d’EPS pour les candidats au bac jusqu’à nouvel ordre. C’est ce qu’ont annoncé, hier, les enseignants d’EPS (éducation physique et sportive) regroupés en association et syndicat. Ils affirment être solidaires avec leurs pairs enseignants des établissements publics, en grève depuis plusieurs semaines faute d’avoir été entendus par leur ministère de tutelle. « Jusqu’à présent, on ignore les enseignants. En tout cas, c’est ainsi que nous interprétons la non- satisfaction des revendications, lesquelles ne datent pas  d’hier et qui sont tout à fait légitimes dans la mesure où les enseignants de l’Education nationale sont les moins lotis, et de loin, des fonctionnaires », se plaignent ces enseignants, qui par ailleurs, réclament la mise en place d’un service spécialement chargé de l’EPS au sein du ministère de l’Education nationale (MEN).

Report. Ainsi, outre les candidats au BEPC dont une grande partie n’a pas encore passé les épreuves d’EPS, les candidats au baccalauréat ne prendront, eux non plus, le départ. Pire, les premiers comme les seconds craignent un nouveau report des examens, lesquels ont déjà été reportés de deux semaines, faisant de cette année scolaire 2017-2018, une année particulièrement longue après les aménagements du calendrier scolaire mis en place par le MEN.

Pour leur part, l’ensemble des enseignants grévistes persistent et signent : «  Nous ne prenons pas en otage les élèves. Au contraire, ce sont les responsables du MEN qui les prennent en otage en nous ignorant », se défendent-ils. « Certaines de ces revendications ont été présentées depuis des années, mais les responsables ministériels ne se pressent pas dans les prises de décision pour les satisfaire, enfin. On nous dit, ces derniers jours que nous devrions rassembler nos revendications, les mettre par écrit et les adresser aux responsables du MEN, mais que nous devons reprendre le travail. Ce que le public ignore peut-être, c’est que nous avons déjà fait tout cela et ce, depuis des années, et à plusieurs reprises, mais quasiment rien ne bouge. C’est la raison pour laquelle nous durcissons le mouvement, cette fois », déclarent les enseignants qui ont assuré vouloir reprendre le travail dès la minute où ils seront « enfin entendus ».  En attendant, les élèves restent privés de classe et attendent qu’une issue soit enfin trouvée.

Hanitra R.

Midi Madagasikara0 partages

RALLYE VISCO NAKANG : La liste des équipages est sortie

Comptant pour la 2e  manche du championnat de rallye 2018, le Rallye VISCO NAKANG organisé par le club ASACM a atteint un nombre d’inscrits record.

Le sérieux de l’organisation et la qualité des spéciales habituellement en très bon état avec l’ASACM a séduit le sponsor. Au niveau des protagonistes on s’attend à un âpre combat entre les ténors, à savoir Fred, le gagnant de la première manche, Tahina associé de nouveau à Baovola sur la Subaru N12B championne 2016/2017 ex Ndrianja, Rivo avec la Subaru R4 plus performante que les groupes N sur le papier, Bona revient aux affaires avec une N8 mieux préparée, sans compter le retour de Tahiana/Tahiry sur Subaru N12B.

Et il y a l’armada des M12 quatre  roues motrices et deux  roues motrices amenée par J Ferré et la surpuissante Subaru ex N10 et Dani sur la 207 RC, à l’affût sûrement la FORD T2 de Teddy avec un nouveau copilote et les autres T2. On a pu voir les M11 (-2000 cm3 atmosphérique) devant certaines T2 lors de la première manche sur certaines spéciales, en figure de proue, la Peugeot 306 S16 de Hugo qui doit tenir 12 spéciales, le clan Clio amené par Tovonen, Fidi, Sitraka…..

Enfin en M10, il y aura sept prétendants, et Legah sera l’homme à battre dans cette catégorie qui surclasse souvent des M1. Le retour de marques de renom d’accessoires auto comme VISCA et NAKANG dans le sport auto montre l’intérêt des distributeurs aux Rallyes chez nous.

Qui succédera à Ndrianja/Fanja vainqueur de la dernière édition ? La réponse ce dimanche après- midi.

La liste des équipages

Anjabob / Nino GolfFrédéric A.T.SubaruDom / Jaona Pa SubaruAndry C 205Bona / Miangaly SubaruDavonjy /Yoan Foton TunlandJordan Naina SubaruFidi -Alain ClioRina –Herz MéganeHugo/Nath 306Freddy / Jimmy R. IsuzuSten / Krick 106Jeffy James / Andry C 206Tsito Mick 207BR Rihe Jackol 205Teddy /Herman Ford RangerNirina /Alcazar Kely 206Rivo /Ando SubaruAlcazaria Mi 205Haja Danielson /Rivo SsangyongJacques / Fafahcop SubaruWilly /TolotraVony /Aina Super 5 GTTovonen Grist ClioPattie Jennie Citroën VisaDani /Hendry 207Miharihaja /Irinala SubaruMaika /Jean Mann 205Tahina /Baovola SubaruTahiana /Tahiry SubaruDomvala /Tita PoloBegue /Princy Rak Citroën SaxoFidy Anjeva / Borman 504Patty /Dads Golf IIIHanitra /Nany Subaru

Anny Andrianaivonirina

Midi Madagasikara0 partages

Affaire « Attentat à la bombe » à Tanjombato : Quatre suspects appréhendés par la gendarmerie

L’enquête sur le terrorisme à la bombe  à la Galerie Smart de  Tanjombato le 7 juin dernier suit son cours. Selon le communiqué émanant de la gendarmerie en date d’hier, quatre personnes suspectées dans cette affaire ont été arrêtées. Deux d’entre elles,  dont une femme, ont été surprises à Anosimahavelona, commune Tanjombato, le lendemain même de la découverte d’objets explosifs dans un colis suspect dans les  toilettes du magasin Jumbo Score qui a marqué le début de ce chapitre ayant semé la panique pendant deux jours. Le 8 juin, la personne qui a affirmé avoir déposé ce colis a encore téléphoné le gérant de ce magasin pour lui exiger  une somme de 10 millions d’ariary en disant que d’autres explosifs prêts à exploser sont encore dissimulés dans le bâtiment.

Le communiqué affirme que ces deux  premières arrestations sont rendues possibles après la détection du numéro du  téléphone qu’ils ont utilisé pour communiquer avec le gérant de Jumbo Score et celui qu’ils ont proposé pour le versement de la rançon exigée. Et cela en collaboration avec les opérateurs de télécommunications que la gendarmerie a tenu à remercier. Deux jours plus tard, un autre suspect qui a également utilisé les mêmes téléphones a  été appréhendé. Puis, la personne qui a déposé le colis au Jumbo Score  fut également traquée. Cette dernière   a reconnu son  acte durant son interrogatoire. Un aveu qui a été enregistré et  concorde  parfaitement avec les images vidéo captées par la caméra de surveillance du magasin.

Plainte contre la gendarmerie. Actuellement, ce présumé poseur de bombe se trouverait dans un hôpital de la capitale. La nuit de sa garde à vue pour le besoin de l’enquête à la gendarmerie, il avait eu un problème de tension artérielle. Il s’est évanoui et a fait une chute. Ainsi, il a été évacué d’urgence à l’hôpital où il suivrait jusqu’à présent   un  traitement. En effet, la reprise de son enquête afin d’établir  le procès verbal de ses dépositions devra attendre sa sortie de l’hôpital. Selon toujours le communiqué de la gendarmerie, cet  homme a, de son côté,  déposé une plainte contre ses enquêteurs. Il accuse ces derniers de l’avoir brutalisé durant son interrogatoire. Ce qui a provoqué sa chute et l’a conduit à l’hôpital.

Pour l’instant, ces quatre suspects sont poursuivis pour acte terroriste.  Quoi qu’il en soit, l’enquête continue selon l’ordre du Procureur du Tribunal de Première instance d’Antananarivo afin d’appréhender  leurs complices.

T.M.

Midi Madagasikara0 partages

« Beach Soccer »- Championnat d’Afrique : « Madagascar aura toutes les cartes en main », estime Cyr...

Le vice-président de la FMF, Cyrille Reboza, affiche un bel optimisme quant aux chances des Barea « beach soccer ».

Madagascar s’est engagé pour le championnat d’Afrique de « beach soccer » qui aura lieu en Egypte vers la première semaine de décembre. Bien au-delà d’un simple engagement, le camp malgache, par le biais du président de la Commission « Beach Soccer » au sein de la FMF, Cyrille Reboza, entend mettre tous les atouts de son côté. Jugez-en plutôt.

Midi Madagasikara : Madagascar a-t-il une chance, voire les moyens de reconquérir le titre de champion d’Afrique de « beach soccer » ?

Cyrille Reboza : « Après notre engagement de principe, Madagascar a déjà gagné une bataille, puisque le match aller contre le Mozambique, notre adversaire aux préliminaires, était prévu à Madagascar.  Nous avons réclamé en arguant le classement FIFA et la CAF est revenue sur sa décision parce que  le premier match aura finalement lieu à Maputo le 7,8 ou 9 septembre et le retour entre le 21 et 23 septembre soit à Mahajanga soit  à Toamasina. Et sur ce dernier point, j’estime que nous gardons toutes nos chances intactes. »

Midi : Mais recevoir au match retour n’est pas tout facile, car il faut se préparer en conséquence.

C.R. : « C’est vrai et c’est la raison pour laquelle nous avons choisi de débuter le regroupement dès le mois d’août jusqu’au départ pour Maputo. Mais bien avant ce regroupement de l’équipe nationale, il y aura un grand tournoi à Toamasina du 20 au 31 juillet pour permettre au staff technique de revoir la liste des présélectionnés en fonction des joueurs en forme du moment.

Après les matches contre le Mozambique, Madagascar sera encore présent au tournoi Cosafa Cup de « beach soccer » aux Seychelles vers fin septembre pour ensuite enchaîner sur un nouveau regroupement qui nous sera très utile pour être au top en Egypte. »

Midi : Vous parlez comme si nous étions déjà qualifiés pour la phase finale de la CAN en Egypte ?

C.R. : « C’est vous dire que nous sommes, le staff technique et la FMF, confiants, surtout si la préparation se déroule comme prévu avec un groupe composé par des anciens et des jeunes très prometteurs. Le dernier et non des moindres c’est ma demande de voir de près les conditions des joueurs pour qu’ils se concentrent mieux sur le championnat d’Afrique et j’en appelle à la compréhension de tout le monde, de la FMF à tous les décideurs pour offrir le maximum à ces joueurs et leurs familles respectives en les aidant par le biais des indemnités ou mieux encore de négocier auprès des employeurs pour qu’ils continuent de percevoir leur salaire durant leur absence assez prolongée. C’est ainsi que nous pouvons regagner le titre de champion d’Afrique. »

Propos recueillis par

Clément RABARY

Midi Madagasikara0 partages

BOINA : Mahajanga Taolam-paty iray gony nafangaro niaraka tamin’ny saribao, saron’ny polisy

Noho ny fanomezam-baovao marim-pototra avy amin’ny olona tsara sitrapo, dia taolam-paty iray gony izay miisa 35 nafatratra tao anaty gonin-tsaribao nafangaro niaraka tamin’ny arina fandrehitra mba tsy hahafantarana an’ireto taolam-paty, no saron’ny polisy ao amin’ny hery vonjy taitra Antanimasaja, tao amin’ny fokontany Aranta, afak’omaly alina tokony ho tamin’ny 11 ora, ka ramatoa iray sahabo 32 taona eo, nitondra an’ireto taolam-paty no voasambotra hatao fanadihadiana lalina amin’izao. Raha ny nambaran’ny kaomisera Ratsirahonana Andriamanana Haja, kaomandin’ny Fip Mahajanga, dia tsy mety manondro ny toerana nakany ireo taolam-paty sy ny olona mety hividy izany ity ramatoa voarohirohy. Hatreto ihany koa, hoy hatrany ity manamboninahitry ny polisim-pirenena ity, dia tsy mbola nisy olona nitaraina ho vaky fasana. Aorian’ny famotorana ataon’ny mpitandro filaminana, dia hatolotra ny fampanaovana tsy ho ela ity mpibizina « saphir blanc ».

Eric Manitrisa

Oniversiten’i Mahajanga

Olana ara-trano, mitokona nanomboka omaly indray ireo mpianatra

Taorian’ny fanambarana nataon’izy ireo tamin’ny haino aman-jery ny alatsinainy teo, tapitra ny 48 ora fe-potoana nomen’ireo mpianatra ny mpitantana ny oniversiten’i Mahajanga momba ny famahana haingana olana ara-trano sy ny famerenana ireo mpianatra miisa 18 izay tsy mahazo miverina mianatra raha tsy amin’ny herintaona, araka ny valin’ny Codis navoakan’ny filankevitra, izay tsy ankasitrahan’ireo mpianatra, ka niverina mitokona indray ireo mpianatra, omaly. Ny andron’ny omaly naraina io, dia nosakanan’ireo mpianatra maro be mitokona ny lalàna miditra ny « campus » Ambondrona, ary tsy avelan’izy ireo ho azo ivezivezena. Raikitra ihany koa ny fandorana kodiarana sy vantan-kazo teny ampovoan’arabe. Ny fototry ny olana, raha ny fampitam-baovao azo, dia takian’ireto mpianatra migrevy ireto ny hamerenana ny fitantanana ny trano amin’ny fikambanana ara-pihaviana efa nijoro hatrizay sy ny hamerenana mianatra tsy misy hataka andro ireo mpianatra efa nahazo fanalefahan-tsazy, kanefa tsy nanaiky izany fangatahana izany ny mpitantana ao amin’ny oniversitén’i Mahajanga. « Tsy marina ny fanambaran’ny filohan’ny oniversite, ny faran’ny herinandro teo, fa tafiditra amin’ny trano avokoa ireo mpianatra miisa 1.023 nanao fangatahana, kanefa maro taminay  mpianatra nameno sy nanatitra taratasy fangatahana no tsy tafiditra anaty lisitra navoaka », raha ny nambaran’ny mpitondratenin’ ireto mpianatra mitokona.

Eric Manitrisa

Ambatomainty

May kila forehitry ny afo nisy nandoro ny biraon’ny lycée

Very fanahy mbola velona ny mpiara-belona, ary ho aiza ihany no hiafaran’ity firenentsika ity ? Efitrano roa mitafo satrana nandrafitra ny biraon’ny lisean’ Ambatomainty, any amin’ny Faritra Melaky, no nisy nandoro, afak’omaly naraina tokony ho tamin’ny dimy ora, ka may kila forehitry ny afo ity tranom-panjakana ity. Araka ny tati-baovao voaray, dia misy mpiambina matory ao amin’io birao io isaky ny alina. Misokatra ankehitriny fanadihadiana sy famotorana ataon’ny mpitandro ny filaminana mahakasika an’ity doro trano ity, izay tsy mbola fantatra mazava tsara hatreto ny antony naha may azy.

Eric Manitrisa

Midi Madagasikara0 partages

RN4 : Taxi-brousse voatafika, voakapa antsy ny mpamily, lasa ny vola sy ny entana

Taxi-brousse roa avy aty an-drenivohitra, handeha ho any amin’iny faritra Sava iny no notafihana andian-jiolahy, tamin’iny lalam-pirenena fahefatra iny, teo anelanelan’i Beanana sy Ambodimanga, samy ao anatin’ny distrika Maevatanana avokoa. Vokany, maromaro ireo mpandeha no naratra vokatry ny vono nataon’ireo olon-dratsy. Lasa tamin’izany kosa ny vola sy ny entana nentin’ireto mpandeha ireto.

Nisesisesy indray tato ho ato ity resaka fanakanan-dalana amin’ny lalam-pirenena ity. Vao haingana tokoa mantsy no nisehoan’izany tany amin’iny lalan’i Morondava iny ka nampitondra takaitra ireo mpamily mpizaha-tany dia vao ny alin’ny talata lasa teo ihany koa, taxi-brousse mitandahatra ho any Sambava no lasibatry ny asan-jiolahy. Maromaro ireo olon-dratsy, raha ny fampitam-baovao azo, izay nametraka hazo nitsivalana tao anaty lalana. Voatery nijanona araka izany ireo fiara ary nihevitra ny handeha hiverina, kanjo nisy nikapa antsy avy hatrany ny tanan’ny iray tamin’ireo mpamily  ka tsy afa-nankaiza intsony izy ireo. Nisy tamin’ireo mpandeha ihany koa no naratra niharan’ny darok’ireto mpanafika ireto. Tombanana ho an-tapitrisany maro ihany ny teti-bidin’ireo zavatra lasan’ireo olon-dratsy tamin’io fotoana io, ary nitsoaka ireo tsy valahara rehefa vita ny asa ratsiny. Nampandrenesina haingana teo ny zandary ary tonga teny amin’ny toerana nisian’ny fanafihana : nanala ilay sakana sy niezaka nikaroka ireo olon-dratsy. Araka ny fampitam-baovao azo hatrany dia tsy niandry ela fa omaly ihany dia fantampantatra ireo olon-dratsy nanafika, izay mponina amina tanana kely iray tsy lavitra teo, nahitana ny sasantsany tamin’ireo entana voaroba. Raha ny re aza dia efa nisy olona noahiahiana ary nentina natao famotorana sahady tany an-toerana.

m.L

Midi Madagasikara0 partages

SAVA : Aéroport Antalaha Faktiora 5 volana tsy voaloa, notapahan’ny Jirama ny jiro

Faktiora dimy volana tsy voaloa, notapahin’ny Jirama ny jiro ao amin’ny seranam-piaramanidin’ Antalaha, ny alatsinainy naraina teo, ary mbola tsy mandeha hatramin’izao, raha araka ny tati-baovao marim-pototra voaray. Etsy adaniny, dia nilaza sy nanizingizina mafy ny avy ao amin’ny orinasam-panjakana Jirama, fa tsy hamerina ny jiro mihitsy izy ireo raha tsy voaloa ny faktiora. Vokatry ny tsy fisian-jiro dia mikatso avokoa ny asa rehetra mila herinaratra ao amin’ity « Aéroport » ity, ary mihasarotra ny fitandroana ny ain’olona amin’ny fifamoivoizana anabakabaka amin’ izao, satria tsy misy fifandraisana azo atao na samy ety an-tany na eny an-tany sy amin’ny habakabaka, hoy ny mpiasa, ary miantso ny tompon’andraikitra hamaha ny olana haingana, ireto farany, mba hisorohana ny loza mety hitranga raha misy sidina mandeha amin’ny seranam-piaramanidin’ Antalaha.

Eric Manitrisa

Midi Madagasikara0 partages

Mpianadahy nitsoaka : Hotsaraina anio ny rainy

Roa herinandro katroka taorian’ny tsy nahitàna popoka an’i Francky sy Jenny dia fantatra fa hiakatra fitsarana anio ny rainy izay efa nidoboka am-ponja hatramin’ny niandohan’ity herinandro ity. Raha tsiahivina dia naterin’ny havan’ny reniny tao amin’ny polisy misahana ny raharaha mahakasika ny zaza tsy ampy taona izy mianadahy tamin’ny zoma lasa teo. Teo vao fantatra fa tena ninia nitsoaka ireo adolantsento, noho ny filazany fa mijaly izy ao amin’ny rainy. Efa maty vady io farany ary dia izy irery no miahy ireo zanany roa, 15 taona ilay vavy ary 14 taona ilay lahikely. Tsy kidnapping  velively araka izay petra-kevitra nandeha izany no nahazo azy mianadahy fa kosafitsoahananytranonytetsyAnosizatoaryfierenatanyamin’nyhavan’nymamany, nohoizayfijaliana na fampijalianaizaynolazainy fa nanjoazydahyizay. Amin’ny maha-tsyampytaonaireompianadahy dia nyhavany no nandray an-tànananyfametrahanafitorianaizaynitarikanyfampidiranaam-ponjailayraim-pianakavianarehefanatolotranyfampanoavanatamin’nyvoalohan’nyherinandrolasateo. Betsakanysiosion-dresakanandehanandritrynytsyfahitànaazyroaarynytenanatahorana dia nyfakàna an-keriny. Tsynisyanefanyantsonandehatanyamin’nyhavany na dia nandefatamin’nytambajotrasosialyaryhitan’nyolonamarobeazanylaharanaizayhahazoanaazyireoamin’nyfampitam-baovao. Vao mainkaniharatsynysainasatriarahatsyfakàna an-kerinyizany dia mety ho zavatrahafaizaymety ho ratsiraitsykokoanohoizaynynanjoireozazatsyampytaona. Nilaminaihanyanefaizanyrehetraizanyrehefanaterinatenyamin’nypolisyireozazaherinandrotatyaoriana. Nyrainykosa no tsyafa-belarehefanisynyfanadihadiananisokatranohonyfitoriana. Tsymbolafantatraizaymety ho endrikafampijalianananjoiretozazaireto, nympanaofanadihadianasynympitsaraihany no afakamamantatraizany. Nyfitsarànamahakasikanyzazatsyampytaonarahateo dia tsyazoatrehin’nyrehetra.

D.R